Cp4.1LG03g12150.1 (mRNA) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACAACAAGAATCTCAAAATCTTGCTTTCTTCTCTTTCTCCTCCTCGTTCAAGATCTTTGTCTCGTTCGAGCTTCGTCGAAGCACTCTTGCAATGGCTCCATAGCTGAGTGTGGTGGTGAAGAAGAGACGTTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAGCAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCACCCAGCTTGTGATGGTGGTGGCGGTGGTCAACCTTACACTAGAAGTGGAAGCTGCGCTCCACCGCCAGCTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCTGACGATTGA ATGACAACAAGAATCTCAAAATCTTGCTTTCTTCTCTTTCTCCTCCTCGTTCAAGATCTTTGTCTCGTTCGAGCTTCGTCGAAGCACTCTTGCAATGGCTCCATAGCTGAGTGTGGTGGTGAAGAAGAGACGTTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAGCAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCACCCAGCTTGTGATGGTGGTGGCGGTGGTCAACCTTACACTAGAAGTGGAAGCTGCGCTCCACCGCCAGCTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCTGACGATTGA ATGACAACAAGAATCTCAAAATCTTGCTTTCTTCTCTTTCTCCTCCTCGTTCAAGATCTTTGTCTCGTTCGAGCTTCGTCGAAGCACTCTTGCAATGGCTCCATAGCTGAGTGTGGTGGTGAAGAAGAGACGTTGATGGAGTCGGAGATAAGTCGAAGGTTTCTCGAACAGCAAAAGAAATACATCTCCATTGGAGCTTTGAAGAAGGATCACCCAGCTTGTGATGGTGGTGGCGGTGGTCAACCTTACACTAGAAGTGGAAGCTGCGCTCCACCGCCAGCTAATCCTTACAATCGAGGCTGCTCTAAGATATATCGTTGTAGGTCTGACGATTGA MTTRISKSCFLLFLLLVQDLCLVRASSKHSCNGSIAECGGEEETLMESEISRRFLEQQKKYISIGALKKDHPACDGGGGGQPYTRSGSCAPPPANPYNRGCSKIYRCRSDD
BLAST of Cp4.1LG03g12150.1 vs. Swiss-Prot
Match: RLF32_ARATH (Protein RALF-like 32 OS=Arabidopsis thaliana GN=RALFL32 PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.3e-19 Identity = 53/113 (46.90%), Postives = 69/113 (61.06%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. Swiss-Prot
Match: RLF1_ARATH (Protein RALF-like 1 OS=Arabidopsis thaliana GN=RALF1 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.9e-11 Identity = 40/79 (50.63%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.6e-10 Identity = 41/86 (47.67%), Postives = 49/86 (56.98%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.6e-10 Identity = 40/81 (49.38%), Postives = 48/81 (59.26%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. Swiss-Prot
Match: RLF24_ARATH (Protein RALF-like 24 OS=Arabidopsis thaliana GN=RALFL24 PE=3 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.2e-08 Identity = 37/79 (46.84%), Postives = 43/79 (54.43%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TrEMBL
Match: A0A0A0L9A8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171840 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 7.5e-46 Identity = 93/109 (85.32%), Postives = 96/109 (88.07%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TrEMBL
Match: C6T1A5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_05G151400 PE=2 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 4.1e-28 Identity = 65/112 (58.04%), Postives = 81/112 (72.32%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TrEMBL
Match: A0A0A0L624_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G171850 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 9.2e-28 Identity = 70/98 (71.43%), Postives = 75/98 (76.53%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TrEMBL
Match: K7L602_SOYBN (Uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.7e-27 Identity = 64/112 (57.14%), Postives = 81/112 (72.32%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TrEMBL
Match: A0A0R0IK43_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_08G108200 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.7e-27 Identity = 64/112 (57.14%), Postives = 81/112 (72.32%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TAIR10
Match: AT4G14010.1 (AT4G14010.1 ralf-like 32) HSP 1 Score: 96.3 bits (238), Expect = 1.3e-20 Identity = 53/113 (46.90%), Postives = 69/113 (61.06%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TAIR10
Match: AT1G02900.1 (AT1G02900.1 rapid alkalinization factor 1) HSP 1 Score: 68.9 bits (167), Expect = 2.2e-12 Identity = 40/79 (50.63%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 65.1 bits (157), Expect = 3.2e-11 Identity = 40/81 (49.38%), Postives = 48/81 (59.26%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TAIR10
Match: AT3G23805.1 (AT3G23805.1 ralf-like 24) HSP 1 Score: 58.5 bits (140), Expect = 2.9e-09 Identity = 37/79 (46.84%), Postives = 43/79 (54.43%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 57.4 bits (137), Expect = 6.6e-09 Identity = 40/95 (42.11%), Postives = 50/95 (52.63%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. NCBI nr
Match: gi|778679218|ref|XP_004147646.2| (PREDICTED: protein RALF-like 32 [Cucumis sativus]) HSP 1 Score: 191.0 bits (484), Expect = 1.1e-45 Identity = 93/109 (85.32%), Postives = 96/109 (88.07%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. NCBI nr
Match: gi|659077106|ref|XP_008439036.1| (PREDICTED: protein RALF-like 32 [Cucumis melo]) HSP 1 Score: 187.2 bits (474), Expect = 1.6e-44 Identity = 90/106 (84.91%), Postives = 95/106 (89.62%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. NCBI nr
Match: gi|351722809|ref|NP_001235977.1| (uncharacterized protein LOC100500295 precursor [Glycine max]) HSP 1 Score: 132.1 bits (331), Expect = 6.0e-28 Identity = 65/112 (58.04%), Postives = 81/112 (72.32%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. NCBI nr
Match: gi|697103835|ref|XP_009605720.1| (PREDICTED: protein RALF-like 32 [Nicotiana tomentosiformis]) HSP 1 Score: 131.3 bits (329), Expect = 1.0e-27 Identity = 64/101 (63.37%), Postives = 77/101 (76.24%), Query Frame = 1
BLAST of Cp4.1LG03g12150.1 vs. NCBI nr
Match: gi|700202095|gb|KGN57228.1| (hypothetical protein Csa_3G171850 [Cucumis sativus]) HSP 1 Score: 131.0 bits (328), Expect = 1.3e-27 Identity = 70/98 (71.43%), Postives = 75/98 (76.53%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
|