CmaCh17G012670.1 (mRNA) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCGTGGTTGTGATCTCAGAACACTACGCTTCCTCGTGGTGGTGCCTTGCGGAGTTGGTTAAGATACTCGAGTATAGAGAGCATACGGGAATGAAGACTATGCCGATCTTTTACAAAGTGGATCCTTCTGATGTTAATGAAGCTAGATTTGGAGAAGATGACTTGAAGGTTCTTCAATGGAGGAAGGCTCTGTTTGAGATCGCCGGCTAA ATGGCCGTGGTTGTGATCTCAGAACACTACGCTTCCTCGTGGTGGTGCCTTGCGGAGTTGGTTAAGATACTCGAGTATAGAGAGCATACGGGAATGAAGACTATGCCGATCTTTTACAAAGTGGATCCTTCTGATGTTAATGAAGCTAGATTTGGAGAAGATGACTTGAAGGTTCTTCAATGGAGGAAGGCTCTGTTTGAGATCGCCGGCTAA ATGGCCGTGGTTGTGATCTCAGAACACTACGCTTCCTCGTGGTGGTGCCTTGCGGAGTTGGTTAAGATACTCGAGTATAGAGAGCATACGGGAATGAAGACTATGCCGATCTTTTACAAAGTGGATCCTTCTGATGTTAATGAAGCTAGATTTGGAGAAGATGACTTGAAGGTTCTTCAATGGAGGAAGGCTCTGTTTGAGATCGCCGGCTAA MAVVVISEHYASSWWCLAELVKILEYREHTGMKTMPIFYKVDPSDVNEARFGEDDLKVLQWRKALFEIAG
BLAST of CmaCh17G012670.1 vs. Swiss-Prot
Match: Y4117_ARATH (Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 8.4e-12 Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. Swiss-Prot
Match: TIR_ARATH (Toll/interleukin-1 receptor-like protein OS=Arabidopsis thaliana GN=TIR PE=1 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.8e-09 Identity = 34/79 (43.04%), Postives = 47/79 (59.49%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. Swiss-Prot
Match: RPP1_ARATH (Probable disease resistance protein RPP1 OS=Arabidopsis thaliana GN=RPP1 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 5.1e-09 Identity = 33/80 (41.25%), Postives = 49/80 (61.25%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. Swiss-Prot
Match: TAO1_ARATH (Disease resistance protein TAO1 OS=Arabidopsis thaliana GN=TAO1 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 6.7e-09 Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. Swiss-Prot
Match: TMVRN_NICGU (TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 6.7e-09 Identity = 34/81 (41.98%), Postives = 46/81 (56.79%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TrEMBL
Match: M5X9W2_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa016235mg PE=4 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.9e-13 Identity = 43/82 (52.44%), Postives = 54/82 (65.85%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TrEMBL
Match: A0A059C7X8_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_E03285 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.0e-12 Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TrEMBL
Match: A0A059C9G9_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_E03292 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.6e-12 Identity = 36/80 (45.00%), Postives = 53/80 (66.25%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TrEMBL
Match: A0A059C6M1_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_E02138 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.6e-12 Identity = 36/80 (45.00%), Postives = 50/80 (62.50%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TrEMBL
Match: A0A059C6X5_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_E025712 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.6e-12 Identity = 32/67 (47.76%), Postives = 49/67 (73.13%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TAIR10
Match: AT4G11170.1 (AT4G11170.1 Disease resistance protein (TIR-NBS-LRR class) family) HSP 1 Score: 70.5 bits (171), Expect = 4.7e-13 Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TAIR10
Match: AT1G72950.1 (AT1G72950.1 Disease resistance protein (TIR-NBS class)) HSP 1 Score: 66.6 bits (161), Expect = 6.8e-12 Identity = 38/81 (46.91%), Postives = 48/81 (59.26%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TAIR10
Match: AT5G40910.1 (AT5G40910.1 Disease resistance protein (TIR-NBS-LRR class) family) HSP 1 Score: 66.2 bits (160), Expect = 8.9e-12 Identity = 39/80 (48.75%), Postives = 49/80 (61.25%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TAIR10
Match: AT5G17680.1 (AT5G17680.1 disease resistance protein (TIR-NBS-LRR class), putative) HSP 1 Score: 64.3 bits (155), Expect = 3.4e-11 Identity = 37/76 (48.68%), Postives = 51/76 (67.11%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. TAIR10
Match: AT1G72930.1 (AT1G72930.1 toll/interleukin-1 receptor-like) HSP 1 Score: 62.8 bits (151), Expect = 9.9e-11 Identity = 34/79 (43.04%), Postives = 47/79 (59.49%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. NCBI nr
Match: gi|659119242|ref|XP_008459550.1| (PREDICTED: TMV resistance protein N-like [Cucumis melo]) HSP 1 Score: 84.7 bits (208), Expect = 6.9e-14 Identity = 43/81 (53.09%), Postives = 53/81 (65.43%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. NCBI nr
Match: gi|702357792|ref|XP_010059170.1| (PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]) HSP 1 Score: 81.6 bits (200), Expect = 5.8e-13 Identity = 39/80 (48.75%), Postives = 53/80 (66.25%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. NCBI nr
Match: gi|645252383|ref|XP_008232097.1| (PREDICTED: TMV resistance protein N-like [Prunus mume]) HSP 1 Score: 81.3 bits (199), Expect = 7.6e-13 Identity = 43/82 (52.44%), Postives = 54/82 (65.85%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. NCBI nr
Match: gi|596059824|ref|XP_007221062.1| (hypothetical protein PRUPE_ppa016235mg [Prunus persica]) HSP 1 Score: 80.9 bits (198), Expect = 9.9e-13 Identity = 43/82 (52.44%), Postives = 54/82 (65.85%), Query Frame = 1
BLAST of CmaCh17G012670.1 vs. NCBI nr
Match: gi|702347495|ref|XP_010057289.1| (PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]) HSP 1 Score: 80.1 bits (196), Expect = 1.7e-12 Identity = 38/80 (47.50%), Postives = 52/80 (65.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
|