CmaCh11G010720.1 (mRNA) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGCAGTGGTGTGGCGCAGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGCTCGTACGGCAACTCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAAACGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA ATGATGCAGTGGTGTGGCGCAGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGCTCGTACGGCAACTCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAAACGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA ATGATGCAGTGGTGTGGCGCAGTAGCTAGGGGAGTGATGGCGGCGGAGCGCCGGTCGCCTTCACTAACGTCGTCAATGGCGGTGGAAGGACTGGTTCCGATCCTTTGTGGACGAGGTGACAAGAAGACGAAGAAGGGGAAAATATTCAAAGGCTCGTACGGCAACTCCAGGCCGAAGAAGGAGAAGAAGATTCAGCGGATCAAGGACAAAAACGAGGTTCCTAGTTCCACTCCTTGGCCTCTTCCTTTCAAGCTCATCTGA MMQWCGAVARGVMAAERRSPSLTSSMAVEGLVPILCGRGDKKTKKGKIFKGSYGNSRPKKEKKIQRIKDKNEVPSSTPWPLPFKLI
BLAST of CmaCh11G010720.1 vs. Swiss-Prot
Match: RT31_ARATH (30S ribosomal protein S31, mitochondrial OS=Arabidopsis thaliana GN=At2g21290 PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 6.9e-24 Identity = 58/95 (61.05%), Postives = 65/95 (68.42%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. Swiss-Prot
Match: RT31_ORYSJ (30S ribosomal protein S31, mitochondrial OS=Oryza sativa subsp. japonica GN=Os09g0528100 PE=3 SV=2) HSP 1 Score: 94.4 bits (233), Expect = 6.7e-19 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. TrEMBL
Match: A0A0A0K141_CUCSA (30S ribosomal protein S31, mitochondrial OS=Cucumis sativus GN=Csa_7G006280 PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 5.5e-36 Identity = 79/86 (91.86%), Postives = 82/86 (95.35%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. TrEMBL
Match: F6I185_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_03s0038g00730 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.5e-25 Identity = 61/86 (70.93%), Postives = 67/86 (77.91%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. TrEMBL
Match: A5AQK5_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_029514 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.5e-25 Identity = 61/86 (70.93%), Postives = 67/86 (77.91%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. TrEMBL
Match: M5VXZ0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013856mg PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.3e-25 Identity = 64/97 (65.98%), Postives = 71/97 (73.20%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. TrEMBL
Match: B9HRF4_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0009s12760g PE=4 SV=2) HSP 1 Score: 120.9 bits (302), Expect = 7.4e-25 Identity = 60/85 (70.59%), Postives = 70/85 (82.35%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. TAIR10
Match: AT2G21290.1 (AT2G21290.1 unknown protein) HSP 1 Score: 110.9 bits (276), Expect = 3.9e-25 Identity = 58/95 (61.05%), Postives = 65/95 (68.42%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. NCBI nr
Match: gi|659094414|ref|XP_008448047.1| (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis melo]) HSP 1 Score: 158.7 bits (400), Expect = 4.6e-36 Identity = 78/86 (90.70%), Postives = 82/86 (95.35%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. NCBI nr
Match: gi|778722736|ref|XP_011658557.1| (PREDICTED: 30S ribosomal protein S31, mitochondrial [Cucumis sativus]) HSP 1 Score: 157.9 bits (398), Expect = 7.8e-36 Identity = 79/86 (91.86%), Postives = 82/86 (95.35%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. NCBI nr
Match: gi|743793489|ref|XP_011047286.1| (PREDICTED: 30S ribosomal protein S31, mitochondrial [Populus euphratica]) HSP 1 Score: 124.8 bits (312), Expect = 7.4e-26 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. NCBI nr
Match: gi|147775816|emb|CAN75923.1| (hypothetical protein VITISV_029514 [Vitis vinifera]) HSP 1 Score: 122.5 bits (306), Expect = 3.7e-25 Identity = 61/86 (70.93%), Postives = 67/86 (77.91%), Query Frame = 1
BLAST of CmaCh11G010720.1 vs. NCBI nr
Match: gi|645262601|ref|XP_008236836.1| (PREDICTED: 30S ribosomal protein S31, mitochondrial [Prunus mume]) HSP 1 Score: 122.5 bits (306), Expect = 3.7e-25 Identity = 64/97 (65.98%), Postives = 72/97 (74.23%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
|