Cla97C05G089240.1 (mRNA) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCATCTGAGGCCCAACAGTTTCCTCCACAGAAGCAACAAGCTCAACCTGGCAAACAGCACGCCATGGACCCGACTCCACAGTTCACTACCTCAGATTATAAGCCTGCCAATAAGCTTCAGGCACCCTTTCTCTCTCTTTCCCTTCTTCCTACTTCACTCTCCTTAATATCATACTAA ATGGCATCTGAGGCCCAACAGTTTCCTCCACAGAAGCAACAAGCTCAACCTGGCAAACAGCACGCCATGGACCCGACTCCACAGTTCACTACCTCAGATTATAAGCCTGCCAATAAGCTTCAGGCACCCTTTCTCTCTCTTTCCCTTCTTCCTACTTCACTCTCCTTAATATCATACTAA ATGGCATCTGAGGCCCAACAGTTTCCTCCACAGAAGCAACAAGCTCAACCTGGCAAACAGCACGCCATGGACCCGACTCCACAGTTCACTACCTCAGATTATAAGCCTGCCAATAAGCTTCAGGCACCCTTTCTCTCTCTTTCCCTTCTTCCTACTTCACTCTCCTTAATATCATACTAA MASEAQQFPPQKQQAQPGKQHAMDPTPQFTTSDYKPANKLQAPFLSLSLLPTSLSLISY
BLAST of Cla97C05G089240.1 vs. NCBI nr
Match: KGN57282.1 (hypothetical protein Csa_3G176290 [Cucumis sativus]) HSP 1 Score: 73.9 bits (180), Expect = 2.0e-10 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. NCBI nr
Match: XP_022922637.1 (NADPH-dependent aldehyde reductase 1, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 73.6 bits (179), Expect = 2.6e-10 Identity = 34/41 (82.93%), Postives = 38/41 (92.68%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. NCBI nr
Match: XP_022985493.1 (NADPH-dependent aldehyde reductase 1, chloroplastic-like [Cucurbita maxima]) HSP 1 Score: 73.6 bits (179), Expect = 2.6e-10 Identity = 34/41 (82.93%), Postives = 38/41 (92.68%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. NCBI nr
Match: XP_004148135.1 (PREDICTED: glucose and ribitol dehydrogenase homolog 1-like [Cucumis sativus]) HSP 1 Score: 72.4 bits (176), Expect = 5.8e-10 Identity = 37/42 (88.10%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. NCBI nr
Match: XP_022140852.1 (NADPH-dependent aldehyde reductase 1, chloroplastic-like [Momordica charantia]) HSP 1 Score: 72.4 bits (176), Expect = 5.8e-10 Identity = 34/41 (82.93%), Postives = 37/41 (90.24%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. TrEMBL
Match: tr|A0A0A0L9H4|A0A0A0L9H4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G176290 PE=4 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-10 Identity = 38/43 (88.37%), Postives = 39/43 (90.70%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. TrEMBL
Match: tr|A0A1S3AYK5|A0A1S3AYK5_CUCME (glucose and ribitol dehydrogenase homolog 1-like OS=Cucumis melo OX=3656 GN=LOC103483994 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.5e-10 Identity = 36/42 (85.71%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. TrEMBL
Match: tr|A0A2H5P9V5|A0A2H5P9V5_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_116980 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 5.5e-09 Identity = 32/44 (72.73%), Postives = 38/44 (86.36%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. TrEMBL
Match: tr|A0A2P5B594|A0A2P5B594_9ROSA (Short-chain dehydrogenase/reductase OS=Trema orientalis OX=63057 GN=TorRG33x02_332430 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.2e-09 Identity = 30/42 (71.43%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. TrEMBL
Match: tr|A0A161XCQ0|A0A161XCQ0_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus OX=79200 GN=DCAR_022182 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.2e-09 Identity = 32/41 (78.05%), Postives = 35/41 (85.37%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. Swiss-Prot
Match: sp|Q5KTS5|GRDH_DAUCA (Glucose and ribitol dehydrogenase OS=Daucus carota OX=4039 GN=CAISE5 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-07 Identity = 25/35 (71.43%), Postives = 30/35 (85.71%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. Swiss-Prot
Match: sp|Q9MA93|GRDH2_ARATH (Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At3g05260 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 5.3e-07 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. Swiss-Prot
Match: sp|Q75KH3|GRDH_ORYSJ (Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica OX=39947 GN=Os05g0140800 PE=2 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 7.0e-07 Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. Swiss-Prot
Match: sp|Q9FZ42|ADRC1_ARATH (NADPH-dependent aldehyde reductase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ChlADR1 PE=1 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 6.5e-05 Identity = 24/41 (58.54%), Postives = 32/41 (78.05%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. TAIR10
Match: AT3G05260.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 54.3 bits (129), Expect = 3.0e-08 Identity = 24/36 (66.67%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of Cla97C05G089240.1 vs. TAIR10
Match: AT1G54870.1 (NAD(P)-binding Rossmann-fold superfamily protein) HSP 1 Score: 47.4 bits (111), Expect = 3.6e-06 Identity = 24/41 (58.54%), Postives = 32/41 (78.05%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
|