Cla97C01G012860.1 (mRNA) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAGATCCAATACTCTGAGAAATACTTTGATGATATCTATGAGTACAGGTCAGTAATTTCTCTTCCTCCTCTGTTTTTCGATTCAGGATGATTTTATGCTCTGGATTTGTTCATCGGCATGGTTTGATTCTCATGTTTGTTGTAGGCATGTAGTGCTTCCTCCTGAAGTCGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAGTAAGTATTTCACGATTCTCCTCTATATCATAATTTCTTGTGTTGAATCCTGTTCCGGTGATCAGTAGTGAAATGAAATAGATATCTCTCATAATCATCGGTTGCTTTTCCTCTGATTGATAAGTGTGATAGAATCTGAATACTTGAGATCTGTGTAATTTGATTATGTGATGATGGACAGAATGAATGGCGAGCCATTGGTGTTCAGCAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCGCACATAATGCTGTTCAGAAGACCACTCAATTATCAACAGCAGCAAGAGAATCAAGCACAGCAGCAGATTATGGCCAAGTGA ATGGGTCAGATCCAATACTCTGAGAAATACTTTGATGATATCTATGAGTACAGGCATGTAGTGCTTCCTCCTGAAGTCGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAAATGAATGGCGAGCCATTGGTGTTCAGCAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCGCACATAATGCTGTTCAGAAGACCACTCAATTATCAACAGCAGCAAGAGAATCAAGCACAGCAGCAGATTATGGCCAAGTGA ATGGGTCAGATCCAATACTCTGAGAAATACTTTGATGATATCTATGAGTACAGGCATGTAGTGCTTCCTCCTGAAGTCGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAAATGAATGGCGAGCCATTGGTGTTCAGCAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCGCACATAATGCTGTTCAGAAGACCACTCAATTATCAACAGCAGCAAGAGAATCAAGCACAGCAGCAGATTATGGCCAAGTGA MGQIQYSEKYFDDIYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQQIMAK
BLAST of Cla97C01G012860.1 vs. NCBI nr
Match: XP_011654109.1 (PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Cucumis sativus] >XP_016903015.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 isoform X2 [Cucumis melo] >KGN64861.1 hypothetical protein Csa_1G132710 [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 3.8e-42 Identity = 86/88 (97.73%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. NCBI nr
Match: XP_010267303.1 (PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] >XP_010267305.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera] >XP_010267306.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera]) HSP 1 Score: 179.9 bits (455), Expect = 3.8e-42 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. NCBI nr
Match: XP_022964884.1 (cyclin-dependent kinases regulatory subunit 1-like [Cucurbita moschata] >XP_022964885.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita moschata] >XP_022970358.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita maxima] >XP_022970359.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita maxima] >XP_023519916.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita pepo subsp. pepo] >XP_023519917.1 cyclin-dependent kinases regulatory subunit 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 178.7 bits (452), Expect = 8.5e-42 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. NCBI nr
Match: XP_016903011.1 (PREDICTED: cyclin-dependent kinases regulatory subunit 1 isoform X1 [Cucumis melo]) HSP 1 Score: 178.3 bits (451), Expect = 1.1e-41 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. NCBI nr
Match: XP_012444712.1 (PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium raimondii] >XP_012444713.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium raimondii] >XP_016750944.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium hirsutum] >XP_016750945.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium hirsutum] >XP_016689183.1 PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium hirsutum] >KJB53545.1 hypothetical protein B456_009G089700 [Gossypium raimondii] >KJB53546.1 hypothetical protein B456_009G089700 [Gossypium raimondii] >KJB53547.1 hypothetical protein B456_009G089700 [Gossypium raimondii] >PPD77560.1 hypothetical protein GOBAR_DD25500 [Gossypium barbadense] >PPR86797.1 hypothetical protein GOBAR_AA33891 [Gossypium barbadense]) HSP 1 Score: 177.9 bits (450), Expect = 1.5e-41 Identity = 84/88 (95.45%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. TrEMBL
Match: tr|A0A1U8AJ97|A0A1U8AJ97_NELNU (Cyclin-dependent kinases regulatory subunit OS=Nelumbo nucifera OX=4432 GN=LOC104604585 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 2.5e-42 Identity = 85/88 (96.59%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. TrEMBL
Match: tr|A0A1S4E4W6|A0A1S4E4W6_CUCME (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo OX=3656 GN=LOC103500769 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 2.5e-42 Identity = 86/88 (97.73%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. TrEMBL
Match: tr|A0A0A0LY04|A0A0A0LY04_CUCSA (Cyclin-dependent kinases regulatory subunit OS=Cucumis sativus OX=3659 GN=Csa_1G132710 PE=3 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 2.5e-42 Identity = 86/88 (97.73%), Postives = 87/88 (98.86%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. TrEMBL
Match: tr|A0A1S4E453|A0A1S4E453_CUCME (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo OX=3656 GN=LOC103500769 PE=3 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 7.4e-42 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. TrEMBL
Match: tr|A0A1U8PIF0|A0A1U8PIF0_GOSHI (Cyclin-dependent kinases regulatory subunit OS=Gossypium hirsutum OX=3635 GN=LOC107959398 PE=3 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 9.6e-42 Identity = 84/88 (95.45%), Postives = 86/88 (97.73%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. Swiss-Prot
Match: sp|O23249|CKS1_ARATH (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CKS1 PE=1 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 7.6e-42 Identity = 79/86 (91.86%), Postives = 83/86 (96.51%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. Swiss-Prot
Match: sp|A2XCH8|CKS1_ORYSI (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica OX=39946 GN=CKS1 PE=2 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 5.1e-38 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. Swiss-Prot
Match: sp|Q6PS57|CKS1_ORYSJ (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CKS1 PE=2 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 5.1e-38 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. Swiss-Prot
Match: sp|Q9SJJ5|CKS2_ARATH (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CKS2 PE=1 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.1e-37 Identity = 71/80 (88.75%), Postives = 77/80 (96.25%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. Swiss-Prot
Match: sp|P55933|CKS1_PHYPO (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum OX=5791 PE=1 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 3.7e-28 Identity = 53/66 (80.30%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. TAIR10
Match: AT2G27960.1 (cyclin-dependent kinase-subunit 1) HSP 1 Score: 170.6 bits (431), Expect = 4.2e-43 Identity = 79/86 (91.86%), Postives = 83/86 (96.51%), Query Frame = 0
BLAST of Cla97C01G012860.1 vs. TAIR10
Match: AT2G27970.1 (CDK-subunit 2) HSP 1 Score: 156.8 bits (395), Expect = 6.3e-39 Identity = 71/80 (88.75%), Postives = 77/80 (96.25%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
|