Cla013103.1 (mRNA) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTCCGGCGGTTACCAAAGGATACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCCAACGATGCCAAATCCCTAGAAGAACTCTTCCACAGAGCTTATAACCACTCCGTTTGGGTTCTGAACAAGGTTTAACTCTTAATTCTCTAATCTTTCAGTTTTGGAATTGTTTTTTTTTTTTTTTTTCTCTCGATTTGTGGATCCGTTTTGAGGGTTGTGGTGATTGGCAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAATTAA ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTCCGGCGGTTACCAAAGGATACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCCAACGATGCCAAATCCCTAGAAGAACTCTTCCACAGAGCTTATAACCACTCCGTTTGGGTTCTGAACAAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAATTAA ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTCCGGCGGTTACCAAAGGATACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCCAACGATGCCAAATCCCTAGAAGAACTCTTCCACAGAGCTTATAACCACTCCGTTTGGGTTCTGAACAAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAATTAA MEKALRIYGEVLRLVRRLPKDTRPYYAKYARENFVNYREVDANDAKSLEELFHRAYNHSVWVLNKYSVDGSAADKLKEICYN
BLAST of Cla013103 vs. Swiss-Prot
Match: LYRM9_ARATH (LYR motif-containing protein At3g19508 OS=Arabidopsis thaliana GN=At3g19508 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.5e-28 Identity = 60/81 (74.07%), Postives = 68/81 (83.95%), Query Frame = 1
BLAST of Cla013103 vs. Swiss-Prot
Match: LYRM9_PHYPA (LYR motif-containing protein PHYPADRAFT_186863 OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_186863 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.1e-10 Identity = 32/58 (55.17%), Postives = 40/58 (68.97%), Query Frame = 1
BLAST of Cla013103 vs. TrEMBL
Match: A0A0A0L970_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G199560 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 3.6e-37 Identity = 76/81 (93.83%), Postives = 79/81 (97.53%), Query Frame = 1
BLAST of Cla013103 vs. TrEMBL
Match: V4SGL4_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10029710mg PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 9.2e-33 Identity = 68/80 (85.00%), Postives = 74/80 (92.50%), Query Frame = 1
BLAST of Cla013103 vs. TrEMBL
Match: A0A0B0Q0M1_GOSAR (Uncharacterized protein OS=Gossypium arboreum GN=F383_11007 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 9.2e-33 Identity = 67/82 (81.71%), Postives = 78/82 (95.12%), Query Frame = 1
BLAST of Cla013103 vs. TrEMBL
Match: A0A061E024_THECC (UPF0631 protein OS=Theobroma cacao GN=TCM_007162 PE=3 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 6.0e-32 Identity = 66/80 (82.50%), Postives = 76/80 (95.00%), Query Frame = 1
BLAST of Cla013103 vs. TrEMBL
Match: A0A067LB24_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_16266 PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 7.8e-32 Identity = 67/80 (83.75%), Postives = 76/80 (95.00%), Query Frame = 1
BLAST of Cla013103 vs. NCBI nr
Match: gi|659112342|ref|XP_008456173.1| (PREDICTED: LYR motif-containing protein At3g19508 [Cucumis melo]) HSP 1 Score: 167.5 bits (423), Expect = 9.4e-39 Identity = 79/82 (96.34%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Cla013103 vs. NCBI nr
Match: gi|449445916|ref|XP_004140718.1| (PREDICTED: LYR motif-containing protein At3g19508 [Cucumis sativus]) HSP 1 Score: 161.8 bits (408), Expect = 5.2e-37 Identity = 76/81 (93.83%), Postives = 79/81 (97.53%), Query Frame = 1
BLAST of Cla013103 vs. NCBI nr
Match: gi|1009150076|ref|XP_015892821.1| (PREDICTED: LYR motif-containing protein At3g19508 [Ziziphus jujuba]) HSP 1 Score: 161.4 bits (407), Expect = 6.8e-37 Identity = 75/82 (91.46%), Postives = 80/82 (97.56%), Query Frame = 1
BLAST of Cla013103 vs. NCBI nr
Match: gi|567860484|ref|XP_006422896.1| (hypothetical protein CICLE_v10029710mg [Citrus clementina]) HSP 1 Score: 147.1 bits (370), Expect = 1.3e-32 Identity = 68/80 (85.00%), Postives = 74/80 (92.50%), Query Frame = 1
BLAST of Cla013103 vs. NCBI nr
Match: gi|728850881|gb|KHG30324.1| (hypothetical protein F383_11007 [Gossypium arboreum]) HSP 1 Score: 147.1 bits (370), Expect = 1.3e-32 Identity = 67/82 (81.71%), Postives = 78/82 (95.12%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
|