Cla011051.1 (mRNA) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGCAAGTATGGCCTGCAGCTTAGGGTTAAGCCATCACAGCAGAAGCAGCCTACAAGACCGCCCCTTCGTGCTCCTCTTGGATTTCAAGAAGATGATGATGATGATGTTGAGAGAGAGATATCCCGCCAAGCTTCCAAGAATAAGGCGCTGAAGGATGTAAGTTAGAACAGGTCTCTTTATTGAGCAAAGATAATGTCATTAACAAGAATCTCAGGGTTGTATGCTAGACTTATTTTATTTTTCCACCTTGAAAAATCAAATTAGATTGAGGAGCAACACAAGAAAGCACTAGAGGAGGATCCGTCTGTTTTTGACTATGATGGAGTCTATGATGAAATGAAAGAAAAGGCTGTTCAACCTCGAGCATATGATCGTGAAGAGCGGAAGGTATGTTCATAA ATGAGCAAGTATGGCCTGCAGCTTAGGGTTAAGCCATCACAGCAGAAGCAGCCTACAAGACCGCCCCTTCGTGCTCCTCTTGGATTTCAAGAAGATGATGATGATGATGTTGAGAGAGAGATATCCCGCCAAGCTTCCAAGAATAAGGCGCTGAAGGATATTGAGGAGCAACACAAGAAAGCACTAGAGGAGGATCCGTCTGTTTTTGACTATGATGGAGTCTATGATGAAATGAAAGAAAAGGCTGTTCAACCTCGAGCATATGATCGTGAAGAGCGGAAGGTATGTTCATAA ATGAGCAAGTATGGCCTGCAGCTTAGGGTTAAGCCATCACAGCAGAAGCAGCCTACAAGACCGCCCCTTCGTGCTCCTCTTGGATTTCAAGAAGATGATGATGATGATGTTGAGAGAGAGATATCCCGCCAAGCTTCCAAGAATAAGGCGCTGAAGGATATTGAGGAGCAACACAAGAAAGCACTAGAGGAGGATCCGTCTGTTTTTGACTATGATGGAGTCTATGATGAAATGAAAGAAAAGGCTGTTCAACCTCGAGCATATGATCGTGAAGAGCGGAAGGTATGTTCATAA MSKYGLQLRVKPSQQKQPTRPPLRAPLGFQEDDDDDVEREISRQASKNKALKDIEEQHKKALEEDPSVFDYDGVYDEMKEKAVQPRAYDREERKVCS
BLAST of Cla011051 vs. Swiss-Prot
Match: NSRP1_MOUSE (Nuclear speckle splicing regulatory protein 1 OS=Mus musculus GN=Nsrp1 PE=1 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.2e-08 Identity = 37/97 (38.14%), Postives = 54/97 (55.67%), Query Frame = 1
BLAST of Cla011051 vs. Swiss-Prot
Match: NSRP1_HUMAN (Nuclear speckle splicing regulatory protein 1 OS=Homo sapiens GN=NSRP1 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.6e-08 Identity = 34/83 (40.96%), Postives = 48/83 (57.83%), Query Frame = 1
BLAST of Cla011051 vs. Swiss-Prot
Match: NSRP1_CAEBR (Nuclear speckle splicing regulatory protein 1 homolog OS=Caenorhabditis briggsae GN=ccdc-55 PE=3 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.7e-08 Identity = 31/85 (36.47%), Postives = 48/85 (56.47%), Query Frame = 1
BLAST of Cla011051 vs. Swiss-Prot
Match: NSRP1_BOVIN (Nuclear speckle splicing regulatory protein 1 OS=Bos taurus GN=NSRP1 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.5e-08 Identity = 33/84 (39.29%), Postives = 47/84 (55.95%), Query Frame = 1
BLAST of Cla011051 vs. Swiss-Prot
Match: NSRP1_RAT (Nuclear speckle splicing regulatory protein 1 OS=Rattus norvegicus GN=Nsrp1 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 6.0e-08 Identity = 35/97 (36.08%), Postives = 54/97 (55.67%), Query Frame = 1
BLAST of Cla011051 vs. TrEMBL
Match: A0A0A0LJE9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G070270 PE=4 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 9.5e-45 Identity = 91/94 (96.81%), Postives = 92/94 (97.87%), Query Frame = 1
BLAST of Cla011051 vs. TrEMBL
Match: A0A061GV10_THECC (Coiled-coil domain-containing protein 55, putative isoform 1 OS=Theobroma cacao GN=TCM_041289 PE=4 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 3.3e-37 Identity = 79/95 (83.16%), Postives = 87/95 (91.58%), Query Frame = 1
BLAST of Cla011051 vs. TrEMBL
Match: A0A0B0NEG8_GOSAR (Nuclear speckle splicing regulatory 1 OS=Gossypium arboreum GN=F383_10067 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 9.5e-37 Identity = 79/95 (83.16%), Postives = 85/95 (89.47%), Query Frame = 1
BLAST of Cla011051 vs. TrEMBL
Match: A0A0D2PQG7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G124100 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 9.5e-37 Identity = 79/95 (83.16%), Postives = 85/95 (89.47%), Query Frame = 1
BLAST of Cla011051 vs. TrEMBL
Match: A0A0D2QPK2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G124100 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 9.5e-37 Identity = 79/95 (83.16%), Postives = 85/95 (89.47%), Query Frame = 1
BLAST of Cla011051 vs. NCBI nr
Match: gi|449470301|ref|XP_004152856.1| (PREDICTED: nuclear speckle splicing regulatory protein 1-like [Cucumis sativus]) HSP 1 Score: 187.2 bits (474), Expect = 1.4e-44 Identity = 91/94 (96.81%), Postives = 92/94 (97.87%), Query Frame = 1
BLAST of Cla011051 vs. NCBI nr
Match: gi|659069555|ref|XP_008450616.1| (PREDICTED: nuclear speckle splicing regulatory protein 1-like [Cucumis melo]) HSP 1 Score: 184.5 bits (467), Expect = 8.8e-44 Identity = 90/94 (95.74%), Postives = 92/94 (97.87%), Query Frame = 1
BLAST of Cla011051 vs. NCBI nr
Match: gi|590586457|ref|XP_007015711.1| (Coiled-coil domain-containing protein 55, putative isoform 1 [Theobroma cacao]) HSP 1 Score: 162.2 bits (409), Expect = 4.7e-37 Identity = 79/95 (83.16%), Postives = 87/95 (91.58%), Query Frame = 1
BLAST of Cla011051 vs. NCBI nr
Match: gi|763741616|gb|KJB09115.1| (hypothetical protein B456_001G124100 [Gossypium raimondii]) HSP 1 Score: 160.6 bits (405), Expect = 1.4e-36 Identity = 79/95 (83.16%), Postives = 85/95 (89.47%), Query Frame = 1
BLAST of Cla011051 vs. NCBI nr
Match: gi|728829958|gb|KHG09401.1| (Nuclear speckle splicing regulatory 1 [Gossypium arboreum]) HSP 1 Score: 160.6 bits (405), Expect = 1.4e-36 Identity = 79/95 (83.16%), Postives = 85/95 (89.47%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
|