Carg23849-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAGCCTGTGGCGATCGGCAACCGGCCAAGATCCAAGTCCAGAGGATTACAAGGGCGTCGAATTCTGGAACAGTCCCGAACGCGCCGGCTGGCTCAACAAGCAGGGTGAATACTTCAAAACCTGGCGTCGCCGTTGGTTCGTTCTGAAACAAGGTAAACTCTTGTGGTTTAAGGACTCTGTTGTTACTCGCGCTTCCATTCCACGCGGTGTCATCCCTGTCAATACCTGCCTCACTGTCAAGGGCGCTGAGGATGTCCTCCATAAGCCTTGCGCCTTCGAGCTCTCTACCACTGGTCAAGACACCATGTATTTTATCGCCAAGTCGGAGCGCGAAAAGGAGGAGTGGATTAATTCGATCGGCCGCTCGATAGTTCAGAATTCGCGATCGGTTACCGAATCTGAAGTCGTTGATTACGATAACAGGCGATGA ATGGAGAGCCTGTGGCGATCGGCAACCGGCCAAGATCCAAGTCCAGAGGATTACAAGGGCGTCGAATTCTGGAACAGTCCCGAACGCGCCGGCTGGCTCAACAAGCAGGGTGAATACTTCAAAACCTGGCGTCGCCGTTGGTTCGTTCTGAAACAAGGTAAACTCTTGTGGTTTAAGGACTCTGTTGTTACTCGCGCTTCCATTCCACGCGGTGTCATCCCTGTCAATACCTGCCTCACTGTCAAGGGCGCTGAGGATGTCCTCCATAAGCCTTGCGCCTTCGAGCTCTCTACCACTGGTCAAGACACCATGTATTTTATCGCCAAGTCGGAGCGCGAAAAGGAGGAGTGGATTAATTCGATCGGCCGCTCGATAGTTCAGAATTCGCGATCGGTTACCGAATCTGAAGTCGTTGATTACGATAACAGGCGATGA ATGGAGAGCCTGTGGCGATCGGCAACCGGCCAAGATCCAAGTCCAGAGGATTACAAGGGCGTCGAATTCTGGAACAGTCCCGAACGCGCCGGCTGGCTCAACAAGCAGGGTGAATACTTCAAAACCTGGCGTCGCCGTTGGTTCGTTCTGAAACAAGGTAAACTCTTGTGGTTTAAGGACTCTGTTGTTACTCGCGCTTCCATTCCACGCGGTGTCATCCCTGTCAATACCTGCCTCACTGTCAAGGGCGCTGAGGATGTCCTCCATAAGCCTTGCGCCTTCGAGCTCTCTACCACTGGTCAAGACACCATGTATTTTATCGCCAAGTCGGAGCGCGAAAAGGAGGAGTGGATTAATTCGATCGGCCGCTCGATAGTTCAGAATTCGCGATCGGTTACCGAATCTGAAGTCGTTGATTACGATAACAGGCGATGA MESLWRSATGQDPSPEDYKGVEFWNSPERAGWLNKQGEYFKTWRRRWFVLKQGKLLWFKDSVVTRASIPRGVIPVNTCLTVKGAEDVLHKPCAFELSTTGQDTMYFIAKSEREKEEWINSIGRSIVQNSRSVTESEVVDYDNRR
BLAST of Carg23849-RA vs. NCBI nr
Match: XP_022947886.1 (pleckstrin homology domain-containing protein 1-like [Cucurbita moschata] >XP_023532322.1 pleckstrin homology domain-containing protein 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 302.4 bits (773), Expect = 8.4e-79 Identity = 144/144 (100.00%), Postives = 144/144 (100.00%), Query Frame = 0
BLAST of Carg23849-RA vs. NCBI nr
Match: XP_023007310.1 (pleckstrin homology domain-containing protein 1-like [Cucurbita maxima]) HSP 1 Score: 301.2 bits (770), Expect = 1.9e-78 Identity = 143/144 (99.31%), Postives = 144/144 (100.00%), Query Frame = 0
BLAST of Carg23849-RA vs. NCBI nr
Match: XP_004143153.1 (PREDICTED: pleckstrin homology domain-containing protein 1 [Cucumis sativus] >XP_008464048.1 PREDICTED: pleckstrin homology domain-containing protein 1 [Cucumis melo] >KGN47090.1 hypothetical protein Csa_6G186365 [Cucumis sativus]) HSP 1 Score: 290.0 bits (741), Expect = 4.3e-75 Identity = 135/144 (93.75%), Postives = 141/144 (97.92%), Query Frame = 0
BLAST of Carg23849-RA vs. NCBI nr
Match: XP_022944633.1 (pleckstrin homology domain-containing protein 1-like [Cucurbita moschata] >XP_022986962.1 pleckstrin homology domain-containing protein 1-like [Cucurbita maxima] >XP_023512687.1 pleckstrin homology domain-containing protein 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 289.7 bits (740), Expect = 5.6e-75 Identity = 135/144 (93.75%), Postives = 140/144 (97.22%), Query Frame = 0
BLAST of Carg23849-RA vs. NCBI nr
Match: XP_022148366.1 (pleckstrin homology domain-containing protein 1-like [Momordica charantia]) HSP 1 Score: 283.5 bits (724), Expect = 4.0e-73 Identity = 131/144 (90.97%), Postives = 138/144 (95.83%), Query Frame = 0
BLAST of Carg23849-RA vs. TAIR10
Match: AT2G29700.1 (pleckstrin homologue 1) HSP 1 Score: 225.7 bits (574), Expect = 1.8e-59 Identity = 108/146 (73.97%), Postives = 126/146 (86.30%), Query Frame = 0
BLAST of Carg23849-RA vs. TAIR10
Match: AT5G05710.1 (Pleckstrin homology (PH) domain superfamily protein) HSP 1 Score: 222.2 bits (565), Expect = 2.0e-58 Identity = 108/144 (75.00%), Postives = 122/144 (84.72%), Query Frame = 0
BLAST of Carg23849-RA vs. Swiss-Prot
Match: sp|Q9ST43|PH1_ARATH (Pleckstrin homology domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PH1 PE=2 SV=2) HSP 1 Score: 225.7 bits (574), Expect = 3.3e-58 Identity = 108/146 (73.97%), Postives = 126/146 (86.30%), Query Frame = 0
BLAST of Carg23849-RA vs. Swiss-Prot
Match: sp|Q86IV4|Y4775_DICDI (PH domain-containing protein DDB_G0274775 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274775 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.3e-09 Identity = 35/98 (35.71%), Postives = 51/98 (52.04%), Query Frame = 0
BLAST of Carg23849-RA vs. Swiss-Prot
Match: sp|O08967|CYH3_MOUSE (Cytohesin-3 OS=Mus musculus OX=10090 GN=Cyth3 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.6e-09 Identity = 45/121 (37.19%), Postives = 58/121 (47.93%), Query Frame = 0
BLAST of Carg23849-RA vs. Swiss-Prot
Match: sp|Q76MY7|CYH2_CHLAE (Cytohesin-2 OS=Chlorocebus aethiops OX=9534 GN=CYTH2 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.4e-08 Identity = 41/121 (33.88%), Postives = 59/121 (48.76%), Query Frame = 0
BLAST of Carg23849-RA vs. Swiss-Prot
Match: sp|Q80TI1|PKHH1_MOUSE (Pleckstrin homology domain-containing family H member 1 OS=Mus musculus OX=10090 GN=Plekhh1 PE=1 SV=2) HSP 1 Score: 59.7 bits (143), Expect = 3.1e-08 Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = 0
BLAST of Carg23849-RA vs. TrEMBL
Match: tr|A0A1S3CL23|A0A1S3CL23_CUCME (pleckstrin homology domain-containing protein 1 OS=Cucumis melo OX=3656 GN=LOC103502029 PE=4 SV=1) HSP 1 Score: 290.0 bits (741), Expect = 2.8e-75 Identity = 135/144 (93.75%), Postives = 141/144 (97.92%), Query Frame = 0
BLAST of Carg23849-RA vs. TrEMBL
Match: tr|A0A0A0KBN3|A0A0A0KBN3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G186365 PE=4 SV=1) HSP 1 Score: 290.0 bits (741), Expect = 2.8e-75 Identity = 135/144 (93.75%), Postives = 141/144 (97.92%), Query Frame = 0
BLAST of Carg23849-RA vs. TrEMBL
Match: tr|A0A2P6QJS4|A0A2P6QJS4_ROSCH (Putative PH domain-containing protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr5g0069011 PE=4 SV=1) HSP 1 Score: 258.1 bits (658), Expect = 1.2e-65 Identity = 119/144 (82.64%), Postives = 130/144 (90.28%), Query Frame = 0
BLAST of Carg23849-RA vs. TrEMBL
Match: tr|A0A2I4GLV8|A0A2I4GLV8_9ROSI (pleckstrin homology domain-containing protein 1 OS=Juglans regia OX=51240 GN=LOC109009005 PE=4 SV=1) HSP 1 Score: 257.3 bits (656), Expect = 2.0e-65 Identity = 120/144 (83.33%), Postives = 133/144 (92.36%), Query Frame = 0
BLAST of Carg23849-RA vs. TrEMBL
Match: tr|A0A2P4HNG8|A0A2P4HNG8_QUESU (Pleckstrin likey domain-containing protein 1 OS=Quercus suber OX=58331 GN=CFP56_74077 PE=4 SV=1) HSP 1 Score: 256.9 bits (655), Expect = 2.7e-65 Identity = 121/144 (84.03%), Postives = 134/144 (93.06%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|