Carg22888-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGAGTCAATTCCCCGTTGTCAACTTGAAGCTCGCCCCGACGCTCCTCCTCGTCGATCGGATATCGATTTCCTCGATTCTATTCTCCTTCGTCGATCGAATACATGACCTTATTTCTCAACCTTGGTCACTATTTCATTCACCCCCCAAAGAAAAGGCTTCCCCACAAGGCAATTCCTTAGAATCTGAGGCCACCCAACACAAAAGCAGCTCAATCAGCAAAGAAGAAGTGAAATTTGTGATGGAAAAGCTTGAGTTTTTTTGCAGCGAGGAGGAAATTGAGGAATCGTGGCTTGGAGGTGAGGAAATAGGTGCCATTTTTGATGAGAGTGAGCCAAGCTTGGAGGAGTTGAAGCAGACATTTAATGTGTTCGATAAGAATAGAGATGGGTGTATTGATGCGGATGAGCTGCAGTCCGTGCTGGGGTTGCTTGTACCTAATCAAGGCGTGTTCATCCATGATTGCCATAGAATGATTGCAAGATTTGATCATAACAAAGATGGTAAAATTGATTTCAATGAGTTTGTTAAGTTTATGGAAATTGCCTTGTCTTGA ATGCCGAGTCAATTCCCCGTTGTCAACTTGAAGCTCGCCCCGACGCTCCTCCTCGTCGATCGGATATCGATTTCCTCGATTCTATTCTCCTTCGTCGATCGAATACATGACCTTATTTCTCAACCTTGGTCACTATTTCATTCACCCCCCAAAGAAAAGGCTTCCCCACAAGGCAATTCCTTAGAATCTGAGGCCACCCAACACAAAAGCAGCTCAATCAGCAAAGAAGAAGTGAAATTTGTGATGGAAAAGCTTGAGTTTTTTTGCAGCGAGGAGGAAATTGAGGAATCGTGGCTTGGAGGTGAGGAAATAGGTGCCATTTTTGATGAGAGTGAGCCAAGCTTGGAGGAGTTGAAGCAGACATTTAATGTGTTCGATAAGAATAGAGATGGGTGTATTGATGCGGATGAGCTGCAGTCCGTGCTGGGGTTGCTTGTACCTAATCAAGGCGTGTTCATCCATGATTGCCATAGAATGATTGCAAGATTTGATCATAACAAAGATGGTAAAATTGATTTCAATGAGTTTGTTAAGTTTATGGAAATTGCCTTGTCTTGA ATGCCGAGTCAATTCCCCGTTGTCAACTTGAAGCTCGCCCCGACGCTCCTCCTCGTCGATCGGATATCGATTTCCTCGATTCTATTCTCCTTCGTCGATCGAATACATGACCTTATTTCTCAACCTTGGTCACTATTTCATTCACCCCCCAAAGAAAAGGCTTCCCCACAAGGCAATTCCTTAGAATCTGAGGCCACCCAACACAAAAGCAGCTCAATCAGCAAAGAAGAAGTGAAATTTGTGATGGAAAAGCTTGAGTTTTTTTGCAGCGAGGAGGAAATTGAGGAATCGTGGCTTGGAGGTGAGGAAATAGGTGCCATTTTTGATGAGAGTGAGCCAAGCTTGGAGGAGTTGAAGCAGACATTTAATGTGTTCGATAAGAATAGAGATGGGTGTATTGATGCGGATGAGCTGCAGTCCGTGCTGGGGTTGCTTGTACCTAATCAAGGCGTGTTCATCCATGATTGCCATAGAATGATTGCAAGATTTGATCATAACAAAGATGGTAAAATTGATTTCAATGAGTTTGTTAAGTTTATGGAAATTGCCTTGTCTTGA MPSQFPVVNLKLAPTLLLVDRISISSILFSFVDRIHDLISQPWSLFHSPPKEKASPQGNSLESEATQHKSSSISKEEVKFVMEKLEFFCSEEEIEESWLGGEEIGAIFDESEPSLEELKQTFNVFDKNRDGCIDADELQSVLGLLVPNQGVFIHDCHRMIARFDHNKDGKIDFNEFVKFMEIALS
BLAST of Carg22888-RA vs. NCBI nr
Match: XP_023003075.1 (probable calcium-binding protein CML30 [Cucurbita maxima]) HSP 1 Score: 358.6 bits (919), Expect = 1.3e-95 Identity = 180/185 (97.30%), Postives = 183/185 (98.92%), Query Frame = 0
BLAST of Carg22888-RA vs. NCBI nr
Match: XP_023530007.1 (probable calcium-binding protein CML30 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 357.1 bits (915), Expect = 3.7e-95 Identity = 179/185 (96.76%), Postives = 184/185 (99.46%), Query Frame = 0
BLAST of Carg22888-RA vs. NCBI nr
Match: XP_022927644.1 (probable calcium-binding protein CML30 [Cucurbita moschata]) HSP 1 Score: 356.7 bits (914), Expect = 4.8e-95 Identity = 181/185 (97.84%), Postives = 183/185 (98.92%), Query Frame = 0
BLAST of Carg22888-RA vs. NCBI nr
Match: XP_023528818.1 (probable calcium-binding protein CML30 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 198.7 bits (504), Expect = 1.7e-47 Identity = 110/189 (58.20%), Postives = 134/189 (70.90%), Query Frame = 0
BLAST of Carg22888-RA vs. NCBI nr
Match: XP_022983385.1 (probable calcium-binding protein CML30 [Cucurbita maxima]) HSP 1 Score: 194.5 bits (493), Expect = 3.2e-46 Identity = 110/191 (57.59%), Postives = 136/191 (71.20%), Query Frame = 0
BLAST of Carg22888-RA vs. TAIR10
Match: AT3G29000.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 112.1 bits (279), Expect = 3.7e-25 Identity = 57/109 (52.29%), Postives = 79/109 (72.48%), Query Frame = 0
BLAST of Carg22888-RA vs. TAIR10
Match: AT5G39670.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 97.4 bits (241), Expect = 9.5e-21 Identity = 53/110 (48.18%), Postives = 72/110 (65.45%), Query Frame = 0
BLAST of Carg22888-RA vs. TAIR10
Match: AT4G12860.1 (EF hand calcium-binding protein family) HSP 1 Score: 62.8 bits (151), Expect = 2.6e-10 Identity = 38/121 (31.40%), Postives = 64/121 (52.89%), Query Frame = 0
BLAST of Carg22888-RA vs. TAIR10
Match: AT5G44460.1 (calmodulin like 43) HSP 1 Score: 61.6 bits (148), Expect = 5.8e-10 Identity = 38/96 (39.58%), Postives = 54/96 (56.25%), Query Frame = 0
BLAST of Carg22888-RA vs. TAIR10
Match: AT3G10190.1 (Calcium-binding EF-hand family protein) HSP 1 Score: 57.8 bits (138), Expect = 8.4e-09 Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of Carg22888-RA vs. Swiss-Prot
Match: sp|Q9MBG5|CML45_ARATH (Probable calcium-binding protein CML45 OS=Arabidopsis thaliana OX=3702 GN=CML45 PE=2 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 6.8e-24 Identity = 57/109 (52.29%), Postives = 79/109 (72.48%), Query Frame = 0
BLAST of Carg22888-RA vs. Swiss-Prot
Match: sp|Q93Z27|CML46_ARATH (Probable calcium-binding protein CML46 OS=Arabidopsis thaliana OX=3702 GN=CML46 PE=1 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 1.7e-19 Identity = 53/110 (48.18%), Postives = 72/110 (65.45%), Query Frame = 0
BLAST of Carg22888-RA vs. Swiss-Prot
Match: sp|Q2QVI1|CML28_ORYSJ (Probable calcium-binding protein CML28 OS=Oryza sativa subsp. japonica OX=39947 GN=CML28 PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 5.6e-10 Identity = 37/80 (46.25%), Postives = 47/80 (58.75%), Query Frame = 0
BLAST of Carg22888-RA vs. Swiss-Prot
Match: sp|Q9SU00|CML2_ARATH (Calmodulin-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=CML2 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 4.7e-09 Identity = 38/121 (31.40%), Postives = 64/121 (52.89%), Query Frame = 0
BLAST of Carg22888-RA vs. Swiss-Prot
Match: sp|Q0DZP5|CML17_ORYSJ (Probable calcium-binding protein CML17 OS=Oryza sativa subsp. japonica OX=39947 GN=CML17 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 1.0e-08 Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 0
BLAST of Carg22888-RA vs. TrEMBL
Match: tr|A0A0A0LHQ5|A0A0A0LHQ5_CUCSA (Calcium-binding EF hand family protein OS=Cucumis sativus OX=3659 GN=Csa_3G825010 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 3.8e-32 Identity = 97/195 (49.74%), Postives = 117/195 (60.00%), Query Frame = 0
BLAST of Carg22888-RA vs. TrEMBL
Match: tr|A0A1S3B8I1|A0A1S3B8I1_CUCME (probable calcium-binding protein CML30 OS=Cucumis melo OX=3656 GN=LOC103487172 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 4.8e-27 Identity = 93/192 (48.44%), Postives = 116/192 (60.42%), Query Frame = 0
BLAST of Carg22888-RA vs. TrEMBL
Match: tr|A0A1Q3B181|A0A1Q3B181_CEPFO (EF_hand_5 domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_05236 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 7.2e-23 Identity = 70/171 (40.94%), Postives = 99/171 (57.89%), Query Frame = 0
BLAST of Carg22888-RA vs. TrEMBL
Match: tr|A0A2N9ER50|A0A2N9ER50_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS5073 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 1.2e-22 Identity = 62/119 (52.10%), Postives = 82/119 (68.91%), Query Frame = 0
BLAST of Carg22888-RA vs. TrEMBL
Match: tr|A0A151TC87|A0A151TC87_CAJCA (Putative calcium-binding protein CML45 OS=Cajanus cajan OX=3821 GN=KK1_019263 PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 4.7e-22 Identity = 66/133 (49.62%), Postives = 91/133 (68.42%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|