Carg22616-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCGCACCAAGCAAACAGCCCGAAAGTCCACCGGCGGTAAGGCTCCTCGTAAGCAATTGGCGACGAAGGCTGCTCGGAAATCGGCTCCGGCGACCGGAGGAGTCAAGAAGCCGCACAGATTCCGTCCAGGGACTGTTGCGCTGAGGGAGATCAGGAAGTACCAGAAGAGCGATTGTTCGAAGATACTAACCTGTGTGCGATTCATGCTAAGAGAGTCACGATTATGCCTAAGGATATTCAATTGGCCAGGCGGATTAGAGGTGAGAGAGCTTAGAGAGCTGTGA ATGGCTCGCACCAAGCAAACAGCCCGAAAGTCCACCGGCGGTAAGGCTCCTCGTAAGCAATTGGCGACGAAGGCTGCTCGGAAATCGGCTCCGGCGACCGGAGGAGTCAAGAAGCCGCACAGATTCCGTCCAGGGACTGTTGCGCTGAGGGAGATCAGGAAGTACCAGAAGAGCGATTGTTCGAAGATACTAACCTGTGTGCGATTCATGCTAAGAGAGTCACGATTATGCCTAAGGATATTCAATTGGCCAGGCGGATTAGAGGTGAGAGAGCTTAGAGAGCTGTGA ATGGCTCGCACCAAGCAAACAGCCCGAAAGTCCACCGGCGGTAAGGCTCCTCGTAAGCAATTGGCGACGAAGGCTGCTCGGAAATCGGCTCCGGCGACCGGAGGAGTCAAGAAGCCGCACAGATTCCGTCCAGGGACTGTTGCGCTGAGGGAGATCAGGAAGTACCAGAAGAGCGATTGTTCGAAGATACTAACCTGTGTGCGATTCATGCTAAGAGAGTCACGATTATGCCTAAGGATATTCAATTGGCCAGGCGGATTAGAGGTGAGAGAGCTTAGAGAGCTGTGA MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSDCSKILTCVRFMLRESRLCLRIFNWPGGLEVRELREL
BLAST of Carg22616-RA vs. NCBI nr
Match: PNI32233.1 (H3F3B isoform 11 [Pan troglodytes]) HSP 1 Score: 123.6 bits (309), Expect = 3.5e-25 Identity = 72/113 (63.72%), Postives = 78/113 (69.03%), Query Frame = 0
BLAST of Carg22616-RA vs. NCBI nr
Match: PNJ87933.1 (H3F3B isoform 4 [Pongo abelii]) HSP 1 Score: 121.3 bits (303), Expect = 1.7e-24 Identity = 71/113 (62.83%), Postives = 77/113 (68.14%), Query Frame = 0
BLAST of Carg22616-RA vs. NCBI nr
Match: PWA66317.1 (RNA-directed DNA polymerase, eukaryota, Reverse transcriptase zinc-binding domain protein [Artemisia annua]) HSP 1 Score: 118.6 bits (296), Expect = 1.1e-23 Identity = 74/118 (62.71%), Postives = 81/118 (68.64%), Query Frame = 0
BLAST of Carg22616-RA vs. NCBI nr
Match: KEH16402.1 (histone H3.2 [Medicago truncatula]) HSP 1 Score: 116.3 bits (290), Expect = 5.6e-23 Identity = 76/137 (55.47%), Postives = 77/137 (56.20%), Query Frame = 0
BLAST of Carg22616-RA vs. NCBI nr
Match: AAV65112.1 (histone 3 [Camellia sinensis]) HSP 1 Score: 109.4 bits (272), Expect = 6.9e-21 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. TAIR10
Match: AT1G09200.1 (Histone superfamily protein) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-24 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. TAIR10
Match: AT3G27360.1 (Histone superfamily protein) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-24 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. TAIR10
Match: AT5G10390.1 (Histone superfamily protein) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-24 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. TAIR10
Match: AT5G10400.1 (Histone superfamily protein) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-24 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. TAIR10
Match: AT5G65360.1 (Histone superfamily protein) HSP 1 Score: 109.4 bits (272), Expect = 1.2e-24 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. Swiss-Prot
Match: sp|P59226|H32_ARATH (Histone H3.2 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2) HSP 1 Score: 109.4 bits (272), Expect = 2.2e-23 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. Swiss-Prot
Match: sp|Q6LBE3|H32_ASPOF (Histone H3.2 OS=Asparagus officinalis OX=4686 PE=2 SV=3) HSP 1 Score: 109.4 bits (272), Expect = 2.2e-23 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. Swiss-Prot
Match: sp|Q6LCK1|H32_BRANA (Histone H3.2 OS=Brassica napus OX=3708 PE=2 SV=3) HSP 1 Score: 109.4 bits (272), Expect = 2.2e-23 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. Swiss-Prot
Match: sp|Q71T45|H32_EUPES (Histone H3.2 OS=Euphorbia esula OX=3993 GN=H3 PE=2 SV=3) HSP 1 Score: 109.4 bits (272), Expect = 2.2e-23 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. Swiss-Prot
Match: sp|Q402E1|H32_LILLO (Histone H3.2 OS=Lilium longiflorum OX=4690 GN=YAH3 PE=1 SV=3) HSP 1 Score: 109.4 bits (272), Expect = 2.2e-23 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of Carg22616-RA vs. TrEMBL
Match: tr|A0A1D5R260|A0A1D5R260_MACMU (Uncharacterized protein OS=Macaca mulatta OX=9544 GN=H3F3B PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 1.4e-25 Identity = 72/113 (63.72%), Postives = 78/113 (69.03%), Query Frame = 0
BLAST of Carg22616-RA vs. TrEMBL
Match: tr|K7EP01|K7EP01_HUMAN (Histone H3.3 OS=Homo sapiens OX=9606 GN=H3F3B PE=1 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.8e-25 Identity = 72/113 (63.72%), Postives = 78/113 (69.03%), Query Frame = 0
BLAST of Carg22616-RA vs. TrEMBL
Match: tr|A0A2J8KB34|A0A2J8KB34_PANTR (H3F3B isoform 11 OS=Pan troglodytes OX=9598 GN=CK820_G0039874 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 2.3e-25 Identity = 72/113 (63.72%), Postives = 78/113 (69.03%), Query Frame = 0
BLAST of Carg22616-RA vs. TrEMBL
Match: tr|A0A1D5R944|A0A1D5R944_MACMU (Uncharacterized protein OS=Macaca mulatta OX=9544 GN=LOC711912 PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 8.9e-25 Identity = 71/113 (62.83%), Postives = 77/113 (68.14%), Query Frame = 0
BLAST of Carg22616-RA vs. TrEMBL
Match: tr|A0A2J8Y104|A0A2J8Y104_PONAB (H3F3B isoform 4 OS=Pongo abelii OX=9601 GN=CR201_G0021391 PE=3 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 1.2e-24 Identity = 71/113 (62.83%), Postives = 77/113 (68.14%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|