Carg17691-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGTCCATTTGCCCGTAGGACGTCTCATTTTGTTTCTAATTTGTTTGTTTCTCATTGCTTGTGCAGGTACAGGTACAAAGACTTTTTCTTTGCCATCATTATTTCAAGTTACTTCAAGATCTTTCTTGTTTGCATGATGGTATACTTTCGACAGTTCTAGTTATTTTCTTTTTGTTGTAGACATTGCTGTTTAATTAATCTAAAATGCATGGAATGAATACTCGTGTATCTTTCTGATATTCGTCGTGTTTTACTGCAGATCTGGGAATTTCCATCTCCAGTGATCTTCATTATAGATTTATTTGTTTTATCATCCAATGTAATAGCAATTAAAGGCAAGGAAGACTTAATTTGTCCGTAG ATGCGTCCATTTGCCCGTAGGACGTCTCATTTTGTTTCTAATTTGTTTGTTTCTCATTGCTTGTGCAGGTACAGGTACAAAGACTTTTTCTTTGCCATCATTATTTCAAGTTACTTCAAGATCTTTCTTGTTTGCATGATGATCTGGGAATTTCCATCTCCAGTGATCTTCATTATAGATTTATTTGTTTTATCATCCAATGTAATAGCAATTAAAGGCAAGGAAGACTTAATTTGTCCGTAG ATGCGTCCATTTGCCCGTAGGACGTCTCATTTTGTTTCTAATTTGTTTGTTTCTCATTGCTTGTGCAGGTACAGGTACAAAGACTTTTTCTTTGCCATCATTATTTCAAGTTACTTCAAGATCTTTCTTGTTTGCATGATGATCTGGGAATTTCCATCTCCAGTGATCTTCATTATAGATTTATTTGTTTTATCATCCAATGTAATAGCAATTAAAGGCAAGGAAGACTTAATTTGTCCGTAG MRPFARRTSHFVSNLFVSHCLCRYRYKDFFFAIIISSYFKIFLVCMMIWEFPSPVIFIIDLFVLSSNVIAIKGKEDLICP
BLAST of Carg17691-RA vs. NCBI nr
Match: XP_022924656.1 (protein arv1 homolog [Cucurbita moschata] >XP_022924657.1 protein arv1 homolog [Cucurbita moschata]) HSP 1 Score: 96.3 bits (238), Expect = 5.1e-17 Identity = 53/65 (81.54%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of Carg17691-RA vs. NCBI nr
Match: XP_023527859.1 (protein arv1 homolog isoform X5 [Cucurbita pepo subsp. pepo] >XP_023527860.1 protein arv1 homolog isoform X5 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 96.3 bits (238), Expect = 5.1e-17 Identity = 53/65 (81.54%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of Carg17691-RA vs. NCBI nr
Match: XP_022979276.1 (uncharacterized protein LOC111479047 isoform X2 [Cucurbita maxima] >XP_022979277.1 uncharacterized protein LOC111479047 isoform X2 [Cucurbita maxima]) HSP 1 Score: 93.6 bits (231), Expect = 3.3e-16 Identity = 52/65 (80.00%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Carg17691-RA vs. NCBI nr
Match: XP_022979274.1 (protein arv1 homolog isoform X1 [Cucurbita maxima] >XP_022979275.1 protein arv1 homolog isoform X1 [Cucurbita maxima]) HSP 1 Score: 93.6 bits (231), Expect = 3.3e-16 Identity = 52/65 (80.00%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Carg17691-RA vs. NCBI nr
Match: XP_011650613.1 (PREDICTED: protein arv1 homolog isoform X1 [Cucumis sativus]) HSP 1 Score: 86.7 bits (213), Expect = 4.0e-14 Identity = 47/66 (71.21%), Postives = 56/66 (84.85%), Query Frame = 0
BLAST of Carg17691-RA vs. TAIR10
Match: AT4G01510.1 (Arv1-like protein) HSP 1 Score: 53.5 bits (127), Expect = 6.8e-08 Identity = 27/48 (56.25%), Postives = 35/48 (72.92%), Query Frame = 0
BLAST of Carg17691-RA vs. TAIR10
Match: AT1G01020.1 (Arv1-like protein) HSP 1 Score: 53.1 bits (126), Expect = 8.9e-08 Identity = 25/48 (52.08%), Postives = 36/48 (75.00%), Query Frame = 0
BLAST of Carg17691-RA vs. Swiss-Prot
Match: sp|Q54GD9|ARV1_DICDI (Protein arv1 homolog OS=Dictyostelium discoideum OX=44689 GN=arv1 PE=3 SV=1) HSP 1 Score: 46.2 bits (108), Expect = 2.0e-04 Identity = 26/48 (54.17%), Postives = 35/48 (72.92%), Query Frame = 0
BLAST of Carg17691-RA vs. TrEMBL
Match: tr|A0A1S4DSU3|A0A1S4DSU3_CUCME (protein arv1 homolog isoform X1 OS=Cucumis melo OX=3656 GN=LOC103483093 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.7e-13 Identity = 46/68 (67.65%), Postives = 56/68 (82.35%), Query Frame = 0
BLAST of Carg17691-RA vs. TrEMBL
Match: tr|A0A1S4DTN2|A0A1S4DTN2_CUCME (protein arv1 homolog isoform X4 OS=Cucumis melo OX=3656 GN=LOC103483093 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.7e-13 Identity = 46/68 (67.65%), Postives = 56/68 (82.35%), Query Frame = 0
BLAST of Carg17691-RA vs. TrEMBL
Match: tr|A0A0A0L5K8|A0A0A0L5K8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G116660 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.7e-13 Identity = 46/65 (70.77%), Postives = 55/65 (84.62%), Query Frame = 0
BLAST of Carg17691-RA vs. TrEMBL
Match: tr|A0A1S3AVD2|A0A1S3AVD2_CUCME (protein arv1 homolog isoform X2 OS=Cucumis melo OX=3656 GN=LOC103483093 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-12 Identity = 45/67 (67.16%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of Carg17691-RA vs. TrEMBL
Match: tr|A0A2T7C052|A0A2T7C052_9POAL (Uncharacterized protein OS=Panicum hallii var. hallii OX=1504633 GN=GQ55_9G060200 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 8.0e-11 Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|