Carg16479-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGCCAAGGAGGAGATTTCACAAGGGGTAATGGAACAGGAGGAGAATCAATCTATGGCATGAAGTTTGCAGATGAAAACTACAAGATGAAACACACCGGACCGGGTGTACTATCAATGGCGAATTCTGGACAGAAACACCAATGGTTCTCAGTTCTTCATTTGTACTGAGAAGACTTCATGGCTGGATGGGAAGCATGTTGTGTTTGGAAAAGTTGTAGATGGTTATAATGTAGTCAAGGAGATGGAGAAGGTGGGATCTGATGGTGGGAGGACTTCTGAAACTGTTGTGATAGAGGACTGCGGGCAGATAGATAGCATCTAG ATGTGCCAAGGAGGAGATTTCACAAGGGGTAATGGAACAGGAGGAGAATCAATCTATGGCATGAAGTTTGCAGATGAAAACTACAAGATGAAACACACCGGACCGGGTGTACTATCAATGGCGAATTCTGGACAGAAACACCAATGGTTCTCAACTTCATGGCTGGATGGGAAGCATGTTGTGTTTGGAAAAGTTGTAGATGGTTATAATGTAGTCAAGGAGATGGAGAAGGTGGGATCTGATGGTGGGAGGACTTCTGAAACTGTTGTGATAGAGGACTGCGGGCAGATAGATAGCATCTAG ATGTGCCAAGGAGGAGATTTCACAAGGGGTAATGGAACAGGAGGAGAATCAATCTATGGCATGAAGTTTGCAGATGAAAACTACAAGATGAAACACACCGGACCGGGTGTACTATCAATGGCGAATTCTGGACAGAAACACCAATGGTTCTCAACTTCATGGCTGGATGGGAAGCATGTTGTGTTTGGAAAAGTTGTAGATGGTTATAATGTAGTCAAGGAGATGGAGAAGGTGGGATCTGATGGTGGGAGGACTTCTGAAACTGTTGTGATAGAGGACTGCGGGCAGATAGATAGCATCTAG MCQGGDFTRGNGTGGESIYGMKFADENYKMKHTGPGVLSMANSGQKHQWFSTSWLDGKHVVFGKVVDGYNVVKEMEKVGSDGGRTSETVVIEDCGQIDSI
BLAST of Carg16479-RA vs. NCBI nr
Match: ANA12002.1 (cyclophilin [Panax ginseng]) HSP 1 Score: 171.8 bits (434), Expect = 1.2e-39 Identity = 84/105 (80.00%), Postives = 92/105 (87.62%), Query Frame = 0
BLAST of Carg16479-RA vs. NCBI nr
Match: OVA02441.1 (Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain [Macleaya cordata]) HSP 1 Score: 169.5 bits (428), Expect = 5.9e-39 Identity = 82/104 (78.85%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of Carg16479-RA vs. NCBI nr
Match: XP_022156642.1 (peptidyl-prolyl cis-trans isomerase CYP19-3 [Momordica charantia]) HSP 1 Score: 169.1 bits (427), Expect = 7.7e-39 Identity = 82/104 (78.85%), Postives = 91/104 (87.50%), Query Frame = 0
BLAST of Carg16479-RA vs. NCBI nr
Match: PSS05006.1 (Peptidyl-prolyl cis-trans isomerase [Actinidia chinensis var. chinensis]) HSP 1 Score: 169.1 bits (427), Expect = 7.7e-39 Identity = 84/104 (80.77%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of Carg16479-RA vs. NCBI nr
Match: PWA85506.1 (cyclophilin [Artemisia annua]) HSP 1 Score: 169.1 bits (427), Expect = 7.7e-39 Identity = 83/104 (79.81%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of Carg16479-RA vs. TAIR10
Match: AT3G56070.1 (rotamase cyclophilin 2) HSP 1 Score: 158.7 bits (400), Expect = 1.9e-39 Identity = 79/104 (75.96%), Postives = 85/104 (81.73%), Query Frame = 0
BLAST of Carg16479-RA vs. TAIR10
Match: AT2G16600.1 (rotamase CYP 3) HSP 1 Score: 149.1 bits (375), Expect = 1.5e-36 Identity = 74/104 (71.15%), Postives = 84/104 (80.77%), Query Frame = 0
BLAST of Carg16479-RA vs. TAIR10
Match: AT2G21130.1 (Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein) HSP 1 Score: 141.0 bits (354), Expect = 4.1e-34 Identity = 68/106 (64.15%), Postives = 83/106 (78.30%), Query Frame = 0
BLAST of Carg16479-RA vs. TAIR10
Match: AT4G38740.1 (rotamase CYP 1) HSP 1 Score: 139.0 bits (349), Expect = 1.5e-33 Identity = 67/104 (64.42%), Postives = 81/104 (77.88%), Query Frame = 0
BLAST of Carg16479-RA vs. TAIR10
Match: AT4G34870.1 (rotamase cyclophilin 5) HSP 1 Score: 137.9 bits (346), Expect = 3.4e-33 Identity = 70/104 (67.31%), Postives = 79/104 (75.96%), Query Frame = 0
BLAST of Carg16479-RA vs. Swiss-Prot
Match: sp|Q38867|CP19C_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana OX=3702 GN=CYP19-3 PE=2 SV=2) HSP 1 Score: 158.7 bits (400), Expect = 3.4e-38 Identity = 79/104 (75.96%), Postives = 85/104 (81.73%), Query Frame = 0
BLAST of Carg16479-RA vs. Swiss-Prot
Match: sp|Q38900|CP19A_ARATH (Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana OX=3702 GN=CYP19-1 PE=2 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 2.7e-35 Identity = 74/104 (71.15%), Postives = 84/104 (80.77%), Query Frame = 0
BLAST of Carg16479-RA vs. Swiss-Prot
Match: sp|Q39613|CYPH_CATRO (Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus OX=4058 GN=PCKR1 PE=1 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 3.9e-34 Identity = 71/104 (68.27%), Postives = 83/104 (79.81%), Query Frame = 0
BLAST of Carg16479-RA vs. Swiss-Prot
Match: sp|P24525|CYPH_BRANA (Peptidyl-prolyl cis-trans isomerase OS=Brassica napus OX=3708 GN=CYP PE=2 SV=2) HSP 1 Score: 144.4 bits (363), Expect = 6.6e-34 Identity = 71/104 (68.27%), Postives = 83/104 (79.81%), Query Frame = 0
BLAST of Carg16479-RA vs. Swiss-Prot
Match: sp|Q8W171|CYP1_SOYBN (Peptidyl-prolyl cis-trans isomerase 1 OS=Glycine max OX=3847 GN=Cyp1 PE=2 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 8.7e-34 Identity = 71/103 (68.93%), Postives = 82/103 (79.61%), Query Frame = 0
BLAST of Carg16479-RA vs. TrEMBL
Match: tr|A0A166JH20|A0A166JH20_PANGI (Peptidyl-prolyl cis-trans isomerase OS=Panax ginseng OX=4054 PE=2 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 7.9e-40 Identity = 84/105 (80.00%), Postives = 92/105 (87.62%), Query Frame = 0
BLAST of Carg16479-RA vs. TrEMBL
Match: tr|A0A200PW43|A0A200PW43_9MAGN (Peptidyl-prolyl cis-trans isomerase OS=Macleaya cordata OX=56857 GN=BVC80_9099g263 PE=3 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 3.9e-39 Identity = 82/104 (78.85%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of Carg16479-RA vs. TrEMBL
Match: tr|A0A2U1PIC6|A0A2U1PIC6_ARTAN (Cyclophilin OS=Artemisia annua OX=35608 GN=CTI12_AA149890 PE=4 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 5.1e-39 Identity = 83/104 (79.81%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of Carg16479-RA vs. TrEMBL
Match: tr|A0A2R6QAT6|A0A2R6QAT6_ACTCH (Peptidyl-prolyl cis-trans isomerase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc20868 PE=3 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 5.1e-39 Identity = 84/104 (80.77%), Postives = 90/104 (86.54%), Query Frame = 0
BLAST of Carg16479-RA vs. TrEMBL
Match: tr|V4VS87|V4VS87_9ROSI (Peptidyl-prolyl cis-trans isomerase OS=Citrus clementina OX=85681 GN=CICLE_v10022535mg PE=3 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 8.7e-39 Identity = 81/104 (77.88%), Postives = 91/104 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|