Carg11516-RA (mRNA) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGTGTTCGTGGGAGGATTCGATCCATTGAAGGATTGGCAGAGGAAATATTATGAATGGCTGAAGAAAAGTGGAAAGAAAGTGGATTTGATCGAATATCCGAAGATGATTCATGCATTTTATTTGTTTCCAGAATTGCCTCACTGTGCTCTGCTCATTAATCAGCTCACAGACTTCGTTTCCAAATGTACGCTCAAATGA ATGGTTGTGTTCGTGGGAGGATTCGATCCATTGAAGGATTGGCAGAGGAAATATTATGAATGGCTGAAGAAAAGTGGAAAGAAAGTGGATTTGATCGAATATCCGAAGATGATTCATGCATTTTATTTGTTTCCAGAATTGCCTCACTGTGCTCTGCTCATTAATCAGCTCACAGACTTCGTTTCCAAATGTACGCTCAAATGA ATGGTTGTGTTCGTGGGAGGATTCGATCCATTGAAGGATTGGCAGAGGAAATATTATGAATGGCTGAAGAAAAGTGGAAAGAAAGTGGATTTGATCGAATATCCGAAGATGATTCATGCATTTTATTTGTTTCCAGAATTGCCTCACTGTGCTCTGCTCATTAATCAGCTCACAGACTTCGTTTCCAAATGTACGCTCAAATGA MVVFVGGFDPLKDWQRKYYEWLKKSGKKVDLIEYPKMIHAFYLFPELPHCALLINQLTDFVSKCTLK
BLAST of Carg11516-RA vs. NCBI nr
Match: XP_022143557.1 (probable carboxylesterase 18 [Momordica charantia]) HSP 1 Score: 114.8 bits (286), Expect = 1.2e-22 Identity = 52/66 (78.79%), Postives = 58/66 (87.88%), Query Frame = 0
BLAST of Carg11516-RA vs. NCBI nr
Match: XP_008451245.1 (PREDICTED: probable carboxylesterase 18 [Cucumis melo]) HSP 1 Score: 114.4 bits (285), Expect = 1.5e-22 Identity = 50/66 (75.76%), Postives = 58/66 (87.88%), Query Frame = 0
BLAST of Carg11516-RA vs. NCBI nr
Match: XP_004148971.1 (PREDICTED: probable carboxylesterase 18 [Cucumis sativus] >KGN44731.1 hypothetical protein Csa_7G375730 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 6.3e-21 Identity = 46/66 (69.70%), Postives = 58/66 (87.88%), Query Frame = 0
BLAST of Carg11516-RA vs. NCBI nr
Match: XP_021890247.1 (probable carboxylesterase 18 [Carica papaya]) HSP 1 Score: 108.6 bits (270), Expect = 8.3e-21 Identity = 47/62 (75.81%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of Carg11516-RA vs. NCBI nr
Match: XP_006426384.1 (probable carboxylesterase 18 [Citrus clementina] >ESR39624.1 hypothetical protein CICLE_v10026049mg [Citrus clementina]) HSP 1 Score: 107.1 bits (266), Expect = 2.4e-20 Identity = 46/62 (74.19%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Carg11516-RA vs. TAIR10
Match: AT5G23530.1 (carboxyesterase 18) HSP 1 Score: 94.4 bits (233), Expect = 2.9e-20 Identity = 41/62 (66.13%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of Carg11516-RA vs. TAIR10
Match: AT5G06570.1 (alpha/beta-Hydrolases superfamily protein) HSP 1 Score: 39.7 bits (91), Expect = 8.6e-04 Identity = 22/64 (34.38%), Postives = 36/64 (56.25%), Query Frame = 0
BLAST of Carg11516-RA vs. Swiss-Prot
Match: sp|Q9LT10|CXE18_ARATH (Probable carboxylesterase 18 OS=Arabidopsis thaliana OX=3702 GN=CXE18 PE=1 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 5.3e-19 Identity = 41/62 (66.13%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of Carg11516-RA vs. TrEMBL
Match: tr|A0A1S3BR05|A0A1S3BR05_CUCME (probable carboxylesterase 18 OS=Cucumis melo OX=3656 GN=LOC103492592 PE=4 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 1.0e-22 Identity = 50/66 (75.76%), Postives = 58/66 (87.88%), Query Frame = 0
BLAST of Carg11516-RA vs. TrEMBL
Match: tr|A0A0A0KA95|A0A0A0KA95_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G375730 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 4.2e-21 Identity = 46/66 (69.70%), Postives = 58/66 (87.88%), Query Frame = 0
BLAST of Carg11516-RA vs. TrEMBL
Match: tr|V4UJX3|V4UJX3_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10026049mg PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.6e-20 Identity = 46/62 (74.19%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Carg11516-RA vs. TrEMBL
Match: tr|A0A2H5NES6|A0A2H5NES6_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_038620 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.6e-20 Identity = 46/62 (74.19%), Postives = 54/62 (87.10%), Query Frame = 0
BLAST of Carg11516-RA vs. TrEMBL
Match: tr|V7C0S7|V7C0S7_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_004G073600g PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 7.9e-20 Identity = 44/61 (72.13%), Postives = 53/61 (86.89%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
|