BhiUN285M37 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCCGTTTAGGGTTCAAATCGGTGGTGTTTCACGGCGACGTTCGTCTTGGGAAACTTGATGCTATTCCGGCCATGGAGCAGAATTTTCAGTTTCCCAACAACGAGATTAGAATCCACCGTATATCGCCACCTAGTGAGAGATGTCCTCTTCTTTTAGTTCTTCAGACAATTTCTTCATTTTCTCTTTGGTGTAAGATACAATCTTCCTTGCCTGTTGAATAG ATGGGCCGTTTAGGGTTCAAATCGGTGGTGTTTCACGGCGACGTTCGTCTTGGGAAACTTGATGCTATTCCGGCCATGGAGCAGAATTTTCAGTTTCCCAACAACGAGATTAGAATCCACCGTATATCGCCACCTAGTGAGAGATGTCCTCTTCTTTTAGTTCTTCAGACAATTTCTTCATTTTCTCTTTGGTGTAAGATACAATCTTCCTTGCCTGTTGAATAG ATGGGCCGTTTAGGGTTCAAATCGGTGGTGTTTCACGGCGACGTTCGTCTTGGGAAACTTGATGCTATTCCGGCCATGGAGCAGAATTTTCAGTTTCCCAACAACGAGATTAGAATCCACCGTATATCGCCACCTAGTGAGAGATGTCCTCTTCTTTTAGTTCTTCAGACAATTTCTTCATTTTCTCTTTGGTGTAAGATACAATCTTCCTTGCCTGTTGAATAG MGRLGFKSVVFHGDVRLGKLDAIPAMEQNFQFPNNEIRIHRISPPSERCPLLLVLQTISSFSLWCKIQSSLPVE
BLAST of BhiUN285M37 vs. TAIR10
Match: AT5G01270.2 (carboxyl-terminal domain (ctd) phosphatase-like 2) HSP 1 Score: 94.4 bits (233), Expect = 3.2e-20 Identity = 44/75 (58.67%), Postives = 58/75 (77.33%), Query Frame = 0
BLAST of BhiUN285M37 vs. TAIR10
Match: AT4G21670.1 (C-terminal domain phosphatase-like 1) HSP 1 Score: 47.4 bits (111), Expect = 4.5e-06 Identity = 29/78 (37.18%), Postives = 37/78 (47.44%), Query Frame = 0
BLAST of BhiUN285M37 vs. Swiss-Prot
Match: sp|Q5YDB5|CPL2_ARATH (RNA polymerase II C-terminal domain phosphatase-like 2 OS=Arabidopsis thaliana OX=3702 GN=CPL2 PE=1 SV=3) HSP 1 Score: 94.4 bits (233), Expect = 5.8e-19 Identity = 44/75 (58.67%), Postives = 58/75 (77.33%), Query Frame = 0
BLAST of BhiUN285M37 vs. Swiss-Prot
Match: sp|Q5YDB6|CPL1_ARATH (RNA polymerase II C-terminal domain phosphatase-like 1 OS=Arabidopsis thaliana OX=3702 GN=CPL1 PE=1 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 8.2e-05 Identity = 29/78 (37.18%), Postives = 37/78 (47.44%), Query Frame = 0
BLAST of BhiUN285M37 vs. TrEMBL
Match: tr|A0A1S3BL37|A0A1S3BL37_CUCME (RNA polymerase II C-terminal domain phosphatase-like 2 OS=Cucumis melo OX=3656 GN=LOC103491217 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.1e-29 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of BhiUN285M37 vs. TrEMBL
Match: tr|A0A0A0L2L8|A0A0A0L2L8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G308610 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.1e-29 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of BhiUN285M37 vs. TrEMBL
Match: tr|A0A059A746|A0A059A746_EUCGR (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_K02986 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.0e-23 Identity = 55/74 (74.32%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of BhiUN285M37 vs. TrEMBL
Match: tr|A0A2I4F2L2|A0A2I4F2L2_9ROSI (RNA polymerase II C-terminal domain phosphatase-like 2 isoform X1 OS=Juglans regia OX=51240 GN=LOC108994920 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.0e-23 Identity = 55/74 (74.32%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of BhiUN285M37 vs. TrEMBL
Match: tr|A0A2I4F2L8|A0A2I4F2L8_9ROSI (RNA polymerase II C-terminal domain phosphatase-like 2 isoform X2 OS=Juglans regia OX=51240 GN=LOC108994920 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.0e-23 Identity = 55/74 (74.32%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of BhiUN285M37 vs. NCBI nr
Match: XP_004147918.1 (PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 2 isoform X1 [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 3.1e-29 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of BhiUN285M37 vs. NCBI nr
Match: XP_008449298.1 (PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 2 [Cucumis melo]) HSP 1 Score: 136.7 bits (343), Expect = 3.1e-29 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of BhiUN285M37 vs. NCBI nr
Match: KGN54371.1 (hypothetical protein Csa_4G308610 [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 3.1e-29 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of BhiUN285M37 vs. NCBI nr
Match: XP_011653684.1 (PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 2 isoform X2 [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 3.1e-29 Identity = 66/74 (89.19%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of BhiUN285M37 vs. NCBI nr
Match: XP_022931888.1 (RNA polymerase II C-terminal domain phosphatase-like 2 isoform X1 [Cucurbita moschata]) HSP 1 Score: 133.7 bits (335), Expect = 2.7e-28 Identity = 64/74 (86.49%), Postives = 69/74 (93.24%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|