Bhi10M001639 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACATCGATTTGGCCCCTCAATTGCCGAAGAAGTTCTATGGTGGTGATGGAAGTTCATATTATTCTTGGCCTCCCAAGGAGCTTCACATGCTCCATGAAGGAAACATTGGCGCCTCCAAGCTCGCCCTTGAAAAGAATGGCTTTGCCCTCCCTCACTACTCTGATTCCGCCAAGGTCTCTTACGTTCTTCAAG ATGGACATCGATTTGGCCCCTCAATTGCCGAAGAAGTTCTATGGTGGTGATGGAAGTTCATATTATTCTTGGCCTCCCAAGGAGCTTCACATGCTCCATGAAGGAAACATTGGCGCCTCCAAGCTCGCCCTTGAAAAGAATGGCTTTGCCCTCCCTCACTACTCTGATTCCGCCAAGGTCTCTTACGTTCTTCAAG ATGGACATCGATTTGGCCCCTCAATTGCCGAAGAAGTTCTATGGTGGTGATGGAAGTTCATATTATTCTTGGCCTCCCAAGGAGCTTCACATGCTCCATGAAGGAAACATTGGCGCCTCCAAGCTCGCCCTTGAAAAGAATGGCTTTGCCCTCCCTCACTACTCTGATTCCGCCAAGGTCTCTTACGTTCTTCAAG MDIDLAPQLPKKFYGGDGSSYYSWPPKELHMLHEGNIGASKLALEKNGFALPHYSDSAKVSYVLQ
BLAST of Bhi10M001639 vs. TAIR10
Match: AT1G07750.1 (RmlC-like cupins superfamily protein) HSP 1 Score: 104.8 bits (260), Expect = 2.1e-23 Identity = 47/65 (72.31%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi10M001639 vs. TAIR10
Match: AT2G28680.1 (RmlC-like cupins superfamily protein) HSP 1 Score: 103.6 bits (257), Expect = 4.7e-23 Identity = 47/65 (72.31%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Bhi10M001639 vs. TrEMBL
Match: tr|A0A1S3CG59|A0A1S3CG59_CUCME (glutelin type-B 5-like OS=Cucumis melo OX=3656 GN=LOC103500083 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 3.0e-24 Identity = 56/65 (86.15%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of Bhi10M001639 vs. TrEMBL
Match: tr|A0A0A0K666|A0A0A0K666_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G281380 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 3.3e-23 Identity = 54/65 (83.08%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi10M001639 vs. TrEMBL
Match: tr|A0A1S2YJV5|A0A1S2YJV5_CICAR (glutelin type-A 2-like OS=Cicer arietinum OX=3827 GN=LOC101510077 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.3e-22 Identity = 52/65 (80.00%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi10M001639 vs. TrEMBL
Match: tr|A0A067L6Y6|A0A067L6Y6_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_05649 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.4e-21 Identity = 51/65 (78.46%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi10M001639 vs. TrEMBL
Match: tr|A0A218W7R8|A0A218W7R8_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CDL15_Pgr025022 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.8e-21 Identity = 51/65 (78.46%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi10M001639 vs. NCBI nr
Match: XP_008461502.1 (PREDICTED: glutelin type-B 5-like [Cucumis melo]) HSP 1 Score: 119.4 bits (298), Expect = 4.5e-24 Identity = 56/65 (86.15%), Postives = 58/65 (89.23%), Query Frame = 0
BLAST of Bhi10M001639 vs. NCBI nr
Match: XP_004150394.1 (PREDICTED: glutelin type-B 5-like isoform X1 [Cucumis sativus] >KGN44409.1 hypothetical protein Csa_7G281380 [Cucumis sativus]) HSP 1 Score: 115.9 bits (289), Expect = 5.0e-23 Identity = 54/65 (83.08%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi10M001639 vs. NCBI nr
Match: XP_011659088.1 (PREDICTED: 11S globulin seed storage protein 2-like isoform X2 [Cucumis sativus]) HSP 1 Score: 115.9 bits (289), Expect = 5.0e-23 Identity = 54/65 (83.08%), Postives = 57/65 (87.69%), Query Frame = 0
BLAST of Bhi10M001639 vs. NCBI nr
Match: XP_022932087.1 (glutelin type-D 1-like [Cucurbita moschata]) HSP 1 Score: 115.5 bits (288), Expect = 6.6e-23 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
BLAST of Bhi10M001639 vs. NCBI nr
Match: XP_022972918.1 (glutelin type-D 1-like [Cucurbita maxima]) HSP 1 Score: 115.5 bits (288), Expect = 6.6e-23 Identity = 54/65 (83.08%), Postives = 56/65 (86.15%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|