Bhi05M001732 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAGATCAGAAGAAAATAGTAGTAATTGGGGAATGTTTGAAGAAGAAGGAGTTCAGAAAATGGAAGGGTTCGTTAAAGGATCGGATTTCATAGAGGTTCATTGCGGCTGCACCAGCAAGAAATATGGCGATTCTTCTGGTAAACTTAGGATTTCTTCTTCTGGCCATTTCTTCATCTTCTGTTTCTGCTCCGATGCCTGTAATGCCGGTATCTCTCTCTCTTCTCTTTCTCCTTCTTATTCTAGTCTTAGAGATTAA ATGATGAGATCAGAAGAAAATAGTAGTAATTGGGGAATGTTTGAAGAAGAAGGAGTTCAGAAAATGGAAGGGTTCGTTAAAGGATCGGATTTCATAGAGGTTCATTGCGGCTGCACCAGCAAGAAATATGGCGATTCTTCTGGTAAACTTAGGATTTCTTCTTCTGGCCATTTCTTCATCTTCTGTTTCTGCTCCGATGCCTGTAATGCCGGTATCTCTCTCTCTTCTCTTTCTCCTTCTTATTCTAGTCTTAGAGATTAA ATGATGAGATCAGAAGAAAATAGTAGTAATTGGGGAATGTTTGAAGAAGAAGGAGTTCAGAAAATGGAAGGGTTCGTTAAAGGATCGGATTTCATAGAGGTTCATTGCGGCTGCACCAGCAAGAAATATGGCGATTCTTCTGGTAAACTTAGGATTTCTTCTTCTGGCCATTTCTTCATCTTCTGTTTCTGCTCCGATGCCTGTAATGCCGGTATCTCTCTCTCTTCTCTTTCTCCTTCTTATTCTAGTCTTAGAGATTAA MMRSEENSSNWGMFEEEGVQKMEGFVKGSDFIEVHCGCTSKKYGDSSGKLRISSSGHFFIFCFCSDACNAGISLSSLSPSYSSLRD
BLAST of Bhi05M001732 vs. Swiss-Prot
Match: sp|Q8GZA8|ULT1_ARATH (Protein ULTRAPETALA 1 OS=Arabidopsis thaliana OX=3702 GN=ULT1 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.4e-08 Identity = 24/57 (42.11%), Postives = 38/57 (66.67%), Query Frame = 0
BLAST of Bhi05M001732 vs. Swiss-Prot
Match: sp|Q8S8I2|ULT2_ARATH (Protein ULTRAPETALA 2 OS=Arabidopsis thaliana OX=3702 GN=ULT2 PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.4e-08 Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 0
BLAST of Bhi05M001732 vs. TAIR10
Match: AT4G28190.2 (Developmental regulator, ULTRAPETALA) HSP 1 Score: 65.9 bits (159), Expect = 1.4e-11 Identity = 30/74 (40.54%), Postives = 47/74 (63.51%), Query Frame = 0
BLAST of Bhi05M001732 vs. TAIR10
Match: AT2G20825.1 (Developmental regulator, ULTRAPETALA) HSP 1 Score: 58.2 bits (139), Expect = 3.0e-09 Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 0
BLAST of Bhi05M001732 vs. TrEMBL
Match: tr|A0A1S3C0C1|A0A1S3C0C1_CUCME (protein ULTRAPETALA 1-like OS=Cucumis melo OX=3656 GN=LOC103495003 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 5.4e-21 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of Bhi05M001732 vs. TrEMBL
Match: tr|A0A0A0LGD6|A0A0A0LGD6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G851820 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 3.0e-19 Identity = 45/53 (84.91%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of Bhi05M001732 vs. TrEMBL
Match: tr|A0A1U8J8I5|A0A1U8J8I5_GOSHI (protein ULTRAPETALA 2-like isoform X2 OS=Gossypium hirsutum OX=3635 GN=LOC107902910 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 1.1e-10 Identity = 34/62 (54.84%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi05M001732 vs. TrEMBL
Match: tr|A0A0D2U109|A0A0D2U109_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_009G431300 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 1.1e-10 Identity = 34/62 (54.84%), Postives = 45/62 (72.58%), Query Frame = 0
BLAST of Bhi05M001732 vs. TrEMBL
Match: tr|A0A1U8NFY3|A0A1U8NFY3_GOSHI (uncharacterized protein LOC107947919 OS=Gossypium hirsutum OX=3635 GN=LOC107947919 PE=4 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 1.1e-10 Identity = 33/59 (55.93%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of Bhi05M001732 vs. NCBI nr
Match: XP_022981597.1 (protein ULTRAPETALA 2-like [Cucurbita maxima]) HSP 1 Score: 113.6 bits (283), Expect = 3.3e-22 Identity = 50/61 (81.97%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Bhi05M001732 vs. NCBI nr
Match: XP_023525873.1 (protein ULTRAPETALA 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 112.1 bits (279), Expect = 9.6e-22 Identity = 49/61 (80.33%), Postives = 55/61 (90.16%), Query Frame = 0
BLAST of Bhi05M001732 vs. NCBI nr
Match: XP_004150103.2 (PREDICTED: protein ULTRAPETALA 1-like [Cucumis sativus]) HSP 1 Score: 111.7 bits (278), Expect = 1.3e-21 Identity = 50/59 (84.75%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of Bhi05M001732 vs. NCBI nr
Match: XP_008454648.1 (PREDICTED: protein ULTRAPETALA 1-like [Cucumis melo]) HSP 1 Score: 109.0 bits (271), Expect = 8.1e-21 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of Bhi05M001732 vs. NCBI nr
Match: XP_022941273.1 (protein ULTRAPETALA 1-like [Cucurbita moschata]) HSP 1 Score: 107.5 bits (267), Expect = 2.4e-20 Identity = 48/61 (78.69%), Postives = 54/61 (88.52%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|