Bhi05M000547 (mRNA) Wax gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAAAGATGGGTTAATTCCTAATGTCTTTACATATAATATACTTTTGAAGGCATTGTGCAAGAATGACCGTGTTGATGCTGCACACAAGCTGTTTGTCGAAATGTCAAGTAACGGCTGCCCACCTTACGTGGTTAACTATACGACTATGGTGTCTTCACTGTGTAAAGCAGGTAAGATTGATGATGCTAGAGAGCTAGCGGGAAGATTTAATGGAAATGTCTAG ATGAAGAAAGATGGGTTAATTCCTAATGTCTTTACATATAATATACTTTTGAAGGCATTGTGCAAGAATGACCGTGTTGATGCTGCACACAAGCTGTTTGTCGAAATGTCAAGTAACGGCTGCCCACCTTACGTGGTTAACTATACGACTATGGTGTCTTCACTGTGTAAAGCAGGTAAGATTGATGATGCTAGAGAGCTAGCGGGAAGATTTAATGGAAATGTCTAG ATGAAGAAAGATGGGTTAATTCCTAATGTCTTTACATATAATATACTTTTGAAGGCATTGTGCAAGAATGACCGTGTTGATGCTGCACACAAGCTGTTTGTCGAAATGTCAAGTAACGGCTGCCCACCTTACGTGGTTAACTATACGACTATGGTGTCTTCACTGTGTAAAGCAGGTAAGATTGATGATGCTAGAGAGCTAGCGGGAAGATTTAATGGAAATGTCTAG MKKDGLIPNVFTYNILLKALCKNDRVDAAHKLFVEMSSNGCPPYVVNYTTMVSSLCKAGKIDDARELAGRFNGNV
BLAST of Bhi05M000547 vs. TAIR10
Match: AT5G46100.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 42.0 bits (97), Expect = 1.9e-04 Identity = 20/37 (54.05%), Postives = 28/37 (75.68%), Query Frame = 0
BLAST of Bhi05M000547 vs. TAIR10
Match: AT2G17525.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 41.6 bits (96), Expect = 2.5e-04 Identity = 19/36 (52.78%), Postives = 21/36 (58.33%), Query Frame = 0
BLAST of Bhi05M000547 vs. TAIR10
Match: AT5G16420.1 (Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 40.8 bits (94), Expect = 4.3e-04 Identity = 15/32 (46.88%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of Bhi05M000547 vs. TrEMBL
Match: tr|A0A1S3VQZ6|A0A1S3VQZ6_VIGRR (pentatricopeptide repeat-containing protein At3g48810 OS=Vigna radiata var. radiata OX=3916 GN=LOC106777539 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.9e-06 Identity = 29/36 (80.56%), Postives = 30/36 (83.33%), Query Frame = 0
BLAST of Bhi05M000547 vs. TrEMBL
Match: tr|A0A1Q3BUQ0|A0A1Q3BUQ0_CEPFO (PPR domain-containing protein/PPR_2 domain-containing protein (Fragment) OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_15171 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.5e-06 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi05M000547 vs. TrEMBL
Match: tr|A0A2G2XPJ9|A0A2G2XPJ9_CAPBA (Uncharacterized protein OS=Capsicum baccatum OX=33114 GN=CQW23_01796 PE=4 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 1.2e-05 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of Bhi05M000547 vs. TrEMBL
Match: tr|A0A0L9UTH3|A0A0L9UTH3_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan06g148100 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.1e-05 Identity = 27/35 (77.14%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of Bhi05M000547 vs. TrEMBL
Match: tr|A0A0S3T0S2|A0A0S3T0S2_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.10G012800 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.1e-05 Identity = 27/35 (77.14%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of Bhi05M000547 vs. NCBI nr
Match: XP_014520617.1 (pentatricopeptide repeat-containing protein At3g48810 [Vigna radiata var. radiata]) HSP 1 Score: 60.5 bits (145), Expect = 2.9e-06 Identity = 29/36 (80.56%), Postives = 30/36 (83.33%), Query Frame = 0
BLAST of Bhi05M000547 vs. NCBI nr
Match: GAV71681.1 (PPR domain-containing protein/PPR_2 domain-containing protein, partial [Cephalotus follicularis]) HSP 1 Score: 60.1 bits (144), Expect = 3.8e-06 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of Bhi05M000547 vs. NCBI nr
Match: GAU34044.1 (hypothetical protein TSUD_16320 [Trifolium subterraneum]) HSP 1 Score: 58.9 bits (141), Expect = 8.4e-06 Identity = 28/36 (77.78%), Postives = 30/36 (83.33%), Query Frame = 0
BLAST of Bhi05M000547 vs. NCBI nr
Match: PHT59433.1 (hypothetical protein CQW23_01796 [Capsicum baccatum]) HSP 1 Score: 57.8 bits (138), Expect = 1.9e-05 Identity = 25/33 (75.76%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of Bhi05M000547 vs. NCBI nr
Match: XP_020216164.1 (pentatricopeptide repeat-containing protein At3g48810 [Cajanus cajan] >XP_020216165.1 pentatricopeptide repeat-containing protein At3g48810 [Cajanus cajan]) HSP 1 Score: 57.4 bits (137), Expect = 2.4e-05 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this mRNA:
GO Assignments
This mRNA is annotated with the following GO terms.
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Analysis Name: InterPro Annotations of wax gourd
Date Performed: 2019-11-17
|