MELO3C024924 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCTACGATGCAAAGAATCTCAGAATCCCACAACTACAATGGATTGGAGCTTTTGCTTCAGATTCTGAGAAATACGATCTACCAGAACAATGTCTCATCCCATTGACATCCAAGGGTGCGGGATCTCACTTGGCACCCACACGTGCACACACGTACGCAGTGCATTTTCAAATGTCATTTTCTGTATTTCTGATCTGTTGAAGGTCTTGTTTAACCTGTCAGACAAGAGAAGAACTGA ATGGCCTACGATGCAAAGAATCTCAGAATCCCACAACTACAATGGATTGGAGCTTTTGCTTCAGATTCTGAGAAATACGATCTACCAGAACAATGTCTCATCCCATTGACATCCAAGGGTGCGGGATCTCACTTGGCACCCACACGTGCACACACACAAGAGAAGAACTGA ATGGCCTACGATGCAAAGAATCTCAGAATCCCACAACTACAATGGATTGGAGCTTTTGCTTCAGATTCTGAGAAATACGATCTACCAGAACAATGTCTCATCCCATTGACATCCAAGGGTGCGGGATCTCACTTGGCACCCACACGTGCACACACACAAGAGAAGAACTGA MAYDAKNLRIPQLQWIGAFASDSEKYDLPEQCLIPLTSKGAGSHLAPTRAHTQEKN*
BLAST of MELO3C024924 vs. Swiss-Prot
Match: SPO11_ARATH (Meiotic recombination protein SPO11-1 OS=Arabidopsis thaliana GN=SPO11-1 PE=1 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 3.5e-08 Identity = 23/39 (58.97%), Postives = 30/39 (76.92%), Query Frame = 1
BLAST of MELO3C024924 vs. TrEMBL
Match: A0A0D2R3D9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G099100 PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 5.8e-10 Identity = 30/40 (75.00%), Postives = 36/40 (90.00%), Query Frame = 1
BLAST of MELO3C024924 vs. TrEMBL
Match: A0A061F4U0_THECC (Spo11/DNA topoisomerase VI OS=Theobroma cacao GN=TCM_030659 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.3e-09 Identity = 29/39 (74.36%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of MELO3C024924 vs. TrEMBL
Match: B9GFL2_POPTR (DNA topoisomerase VIA family protein OS=Populus trichocarpa GN=POPTR_0001s37540g PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 3.8e-09 Identity = 28/39 (71.79%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of MELO3C024924 vs. TrEMBL
Match: W9QQJ3_9ROSA (Meiotic recombination protein SPO11-1 OS=Morus notabilis GN=L484_018233 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-08 Identity = 28/39 (71.79%), Postives = 35/39 (89.74%), Query Frame = 1
BLAST of MELO3C024924 vs. TrEMBL
Match: A0A022QJM3_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a019434mg PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 1.9e-08 Identity = 26/39 (66.67%), Postives = 35/39 (89.74%), Query Frame = 1
BLAST of MELO3C024924 vs. TAIR10
Match: AT3G13170.1 (AT3G13170.1 Spo11/DNA topoisomerase VI, subunit A protein) HSP 1 Score: 58.2 bits (139), Expect = 2.0e-09 Identity = 23/39 (58.97%), Postives = 30/39 (76.92%), Query Frame = 1
BLAST of MELO3C024924 vs. TAIR10
Match: AT5G02820.1 (AT5G02820.1 Spo11/DNA topoisomerase VI, subunit A protein) HSP 1 Score: 48.9 bits (115), Expect = 1.2e-06 Identity = 18/39 (46.15%), Postives = 26/39 (66.67%), Query Frame = 1
BLAST of MELO3C024924 vs. NCBI nr
Match: gi|659126052|ref|XP_008462990.1| (PREDICTED: meiotic recombination protein SPO11-1 isoform X2 [Cucumis melo]) HSP 1 Score: 84.0 bits (206), Expect = 9.5e-14 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 1
BLAST of MELO3C024924 vs. NCBI nr
Match: gi|659126054|ref|XP_008462991.1| (PREDICTED: meiotic recombination protein SPO11-1 isoform X3 [Cucumis melo]) HSP 1 Score: 84.0 bits (206), Expect = 9.5e-14 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 1
BLAST of MELO3C024924 vs. NCBI nr
Match: gi|659126050|ref|XP_008462989.1| (PREDICTED: meiotic recombination protein SPO11-1 isoform X1 [Cucumis melo]) HSP 1 Score: 84.0 bits (206), Expect = 9.5e-14 Identity = 39/39 (100.00%), Postives = 39/39 (100.00%), Query Frame = 1
BLAST of MELO3C024924 vs. NCBI nr
Match: gi|763746431|gb|KJB13870.1| (hypothetical protein B456_002G099100 [Gossypium raimondii]) HSP 1 Score: 70.9 bits (172), Expect = 8.4e-10 Identity = 30/40 (75.00%), Postives = 36/40 (90.00%), Query Frame = 1
BLAST of MELO3C024924 vs. NCBI nr
Match: gi|590605586|ref|XP_007020526.1| (Spo11/DNA topoisomerase VI [Theobroma cacao]) HSP 1 Score: 69.7 bits (169), Expect = 1.9e-09 Identity = 29/39 (74.36%), Postives = 36/39 (92.31%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|