MELO3C020234 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTCCGAACATGTTTGAGGCATTAACCTTAAGAGAGACCCAAGAGTATGATCTAAATGAAGCTATTCGTGTGCATGATACCCCAGAGGGCACATGTCTGCAAGAAAATCCATATGCATTAACATCATTGGCGCCAAGGTTATGGCCATTTATGAGGCACAGTATCACATCAGTTCGTTATTCAGCTATACGTACTTTGGTAGAATATCTTCAATGTTCTAATTATTTTCCATGGAAAAATTGTAGTTAGTTCAGTACAACGTTCATTACATTTACATGTTCCATGCTAAATTGATATTGATTTTTTCATTTCTTTCATCAACCAATATTCAATTTTACAGGAACGGTTGCTAGAAGCAGGATTGAAACAAAATATTTCTGTGCCTTCTACTGCCATTTGGCCGACTACCATTTTGGGTGA ATGTTTCCGAACATGTTTGAGGCATTAACCTTAAGAGAGACCCAAGAGTATGATCTAAATGAAGCTATTCGTGTGCATGATACCCCAGAGGGCACATGTCTGCAAGAAAATCCATATGCATTAACATCATTGGCGCCAAGGTTATGGCCATTTATGAGGCACAGTATCACATCAGTTCGTTATTCAGCTATACGAACGGTTGCTAGAAGCAGGATTGAAACAAAATATTTCTGTGCCTTCTACTGCCATTTGGCCGACTACCATTTTGGGTGA ATGTTTCCGAACATGTTTGAGGCATTAACCTTAAGAGAGACCCAAGAGTATGATCTAAATGAAGCTATTCGTGTGCATGATACCCCAGAGGGCACATGTCTGCAAGAAAATCCATATGCATTAACATCATTGGCGCCAAGGTTATGGCCATTTATGAGGCACAGTATCACATCAGTTCGTTATTCAGCTATACGAACGGTTGCTAGAAGCAGGATTGAAACAAAATATTTCTGTGCCTTCTACTGCCATTTGGCCGACTACCATTTTGGGTGA MFPNMFEALTLRETQEYDLNEAIRVHDTPEGTCLQENPYALTSLAPRLWPFMRHSITSVRYSAIRTVARSRIETKYFCAFYCHLADYHFG*
BLAST of MELO3C020234 vs. Swiss-Prot
Match: BTAF1_ARATH (TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.2e-12 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 1
BLAST of MELO3C020234 vs. TrEMBL
Match: A0A0A0L730_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G305660 PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 8.1e-30 Identity = 65/69 (94.20%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of MELO3C020234 vs. TrEMBL
Match: M5WK27_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000203mg PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 1.2e-17 Identity = 46/69 (66.67%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of MELO3C020234 vs. TrEMBL
Match: F6I5H6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_15s0024g00350 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.1e-17 Identity = 46/69 (66.67%), Postives = 53/69 (76.81%), Query Frame = 1
BLAST of MELO3C020234 vs. TrEMBL
Match: B9SD95_RICCO (TATA-binding protein-associated factor MOT1, putative OS=Ricinus communis GN=RCOM_1515310 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.1e-15 Identity = 44/65 (67.69%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of MELO3C020234 vs. TrEMBL
Match: A0A0D2VHS4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G197700 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.9e-15 Identity = 43/69 (62.32%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of MELO3C020234 vs. TAIR10
Match: AT3G54280.2 (AT3G54280.2 DNA binding;ATP binding;nucleic acid binding;binding;helicases;ATP binding;DNA binding;helicases) HSP 1 Score: 72.8 bits (177), Expect = 1.2e-13 Identity = 36/65 (55.38%), Postives = 43/65 (66.15%), Query Frame = 1
BLAST of MELO3C020234 vs. NCBI nr
Match: gi|659114355|ref|XP_008457028.1| (PREDICTED: TATA-binding protein-associated factor BTAF1 [Cucumis melo]) HSP 1 Score: 141.4 bits (355), Expect = 8.0e-31 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of MELO3C020234 vs. NCBI nr
Match: gi|778680790|ref|XP_011651396.1| (PREDICTED: TATA-binding protein-associated factor BTAF1 [Cucumis sativus]) HSP 1 Score: 137.5 bits (345), Expect = 1.2e-29 Identity = 65/69 (94.20%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of MELO3C020234 vs. NCBI nr
Match: gi|700202662|gb|KGN57795.1| (hypothetical protein Csa_3G305660 [Cucumis sativus]) HSP 1 Score: 137.5 bits (345), Expect = 1.2e-29 Identity = 65/69 (94.20%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of MELO3C020234 vs. NCBI nr
Match: gi|595842311|ref|XP_007208394.1| (hypothetical protein PRUPE_ppa000203mg [Prunus persica]) HSP 1 Score: 97.1 bits (240), Expect = 1.7e-17 Identity = 46/69 (66.67%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of MELO3C020234 vs. NCBI nr
Match: gi|645215128|ref|XP_008219029.1| (PREDICTED: TATA-binding protein-associated factor BTAF1 [Prunus mume]) HSP 1 Score: 96.7 bits (239), Expect = 2.3e-17 Identity = 46/69 (66.67%), Postives = 55/69 (79.71%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|