MELO3C019477.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA MIKRFVKWLILHSTCIPDSCIVNIYDEGDCIPPHIDHHDFLRPFCTVSFQTESNIIFGTRLEVLSPREFSGPVSTPLL
BLAST of MELO3C019477.2 vs. NCBI nr
Match: XP_022149186.1 (RNA demethylase ALKBH5-like [Momordica charantia]) HSP 1 Score: 147.9 bits (372), Expect = 1.4e-32 Identity = 66/77 (85.71%), Postives = 70/77 (90.91%), Query Frame = 0
BLAST of MELO3C019477.2 vs. NCBI nr
Match: XP_021672522.1 (uncharacterized protein LOC110659008 [Hevea brasiliensis]) HSP 1 Score: 141.7 bits (356), Expect = 1.0e-30 Identity = 62/77 (80.52%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MELO3C019477.2 vs. NCBI nr
Match: XP_021617214.1 (uncharacterized protein LOC110618397 isoform X1 [Manihot esculenta] >OAY44915.1 hypothetical protein MANES_07G016100 [Manihot esculenta]) HSP 1 Score: 140.6 bits (353), Expect = 2.3e-30 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of MELO3C019477.2 vs. NCBI nr
Match: XP_021617215.1 (uncharacterized protein LOC110618397 isoform X2 [Manihot esculenta]) HSP 1 Score: 140.6 bits (353), Expect = 2.3e-30 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of MELO3C019477.2 vs. NCBI nr
Match: EOX97320.1 (Oxidoreductase, putative [Theobroma cacao]) HSP 1 Score: 139.8 bits (351), Expect = 3.9e-30 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TAIR10
Match: AT4G36090.3 (oxidoreductase, 2OG-Fe(II) oxygenase family protein) HSP 1 Score: 123.2 bits (308), Expect = 6.9e-29 Identity = 54/77 (70.13%), Postives = 63/77 (81.82%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TAIR10
Match: AT2G17970.1 (2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 121.3 bits (303), Expect = 2.6e-28 Identity = 50/77 (64.94%), Postives = 64/77 (83.12%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TAIR10
Match: AT1G48980.1 (2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 117.9 bits (294), Expect = 2.9e-27 Identity = 49/71 (69.01%), Postives = 59/71 (83.10%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TAIR10
Match: AT4G02940.1 (oxidoreductase, 2OG-Fe(II) oxygenase family protein) HSP 1 Score: 40.4 bits (93), Expect = 5.8e-04 Identity = 20/77 (25.97%), Postives = 38/77 (49.35%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TrEMBL
Match: tr|A0A2C9VHM6|A0A2C9VHM6_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_07G016100 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.5e-30 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TrEMBL
Match: tr|A0A061DXA1|A0A061DXA1_THECC (Oxidoreductase, putative OS=Theobroma cacao OX=3641 GN=TCM_006385 PE=4 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 2.6e-30 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TrEMBL
Match: tr|A0A2G5CH57|A0A2G5CH57_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_05700108v1 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 2.9e-29 Identity = 60/77 (77.92%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TrEMBL
Match: tr|A0A2G5C0M3|A0A2G5C0M3_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_22100001v1 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 2.9e-29 Identity = 60/77 (77.92%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of MELO3C019477.2 vs. TrEMBL
Match: tr|A0A1R3HYJ1|A0A1R3HYJ1_COCAP (Oxoglutarate/iron-dependent dioxygenase OS=Corchorus capsularis OX=210143 GN=CCACVL1_16203 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 2.9e-29 Identity = 60/77 (77.92%), Postives = 67/77 (87.01%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|