MELO3C019477 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA ATGATCAAGAGATTCGTGAAGTGGCTGATTCTACATAGTACATGCATCCCCGATAGCTGCATCGTAAACATATATGATGAAGGAGATTGCATTCCTCCACACATTGATCACCATGATTTTCTAAGACCCTTTTGCACTGTGTCATTTCAAACAGAAAGTAACATCATATTTGGCACTCGACTAGAAGTTCTTAGTCCTAGAGAGTTCTCTGGTCCTGTCTCGACTCCTTTGCTCTAA MIKRFVKWLILHSTCIPDSCIVNIYDEGDCIPPHIDHHDFLRPFCTVSFQTESNIIFGTRLEVLSPREFSGPVSTPLL*
BLAST of MELO3C019477 vs. TrEMBL
Match: A0A061DXA1_THECC (Oxidoreductase, putative OS=Theobroma cacao GN=TCM_006385 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 4.1e-30 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 1
BLAST of MELO3C019477 vs. TrEMBL
Match: A0A067DCM5_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g025324mg PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 4.6e-29 Identity = 59/77 (76.62%), Postives = 67/77 (87.01%), Query Frame = 1
BLAST of MELO3C019477 vs. TrEMBL
Match: A0A067L300_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_05032 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 7.8e-29 Identity = 59/77 (76.62%), Postives = 67/77 (87.01%), Query Frame = 1
BLAST of MELO3C019477 vs. TrEMBL
Match: M5XYM5_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa007067mg PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 7.8e-29 Identity = 60/77 (77.92%), Postives = 66/77 (85.71%), Query Frame = 1
BLAST of MELO3C019477 vs. TrEMBL
Match: A0A0K9RJN1_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_058830 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.3e-28 Identity = 58/77 (75.32%), Postives = 66/77 (85.71%), Query Frame = 1
BLAST of MELO3C019477 vs. TAIR10
Match: AT4G36090.3 (AT4G36090.3 oxidoreductase, 2OG-Fe(II) oxygenase family protein) HSP 1 Score: 121.7 bits (304), Expect = 2.0e-28 Identity = 54/77 (70.13%), Postives = 61/77 (79.22%), Query Frame = 1
BLAST of MELO3C019477 vs. TAIR10
Match: AT2G17970.1 (AT2G17970.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 119.8 bits (299), Expect = 7.7e-28 Identity = 50/77 (64.94%), Postives = 62/77 (80.52%), Query Frame = 1
BLAST of MELO3C019477 vs. TAIR10
Match: AT1G48980.1 (AT1G48980.1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein) HSP 1 Score: 116.3 bits (290), Expect = 8.5e-27 Identity = 49/71 (69.01%), Postives = 57/71 (80.28%), Query Frame = 1
BLAST of MELO3C019477 vs. NCBI nr
Match: gi|590682988|ref|XP_007041489.1| (Oxidoreductase, putative [Theobroma cacao]) HSP 1 Score: 138.3 bits (347), Expect = 5.9e-30 Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 1
BLAST of MELO3C019477 vs. NCBI nr
Match: gi|645223774|ref|XP_008218793.1| (PREDICTED: uncharacterized protein LOC103319079 [Prunus mume]) HSP 1 Score: 136.0 bits (341), Expect = 2.9e-29 Identity = 61/77 (79.22%), Postives = 66/77 (85.71%), Query Frame = 1
BLAST of MELO3C019477 vs. NCBI nr
Match: gi|641820898|gb|KDO40724.1| (hypothetical protein CISIN_1g025324mg [Citrus sinensis]) HSP 1 Score: 134.8 bits (338), Expect = 6.5e-29 Identity = 59/77 (76.62%), Postives = 67/77 (87.01%), Query Frame = 1
BLAST of MELO3C019477 vs. NCBI nr
Match: gi|596287206|ref|XP_007225739.1| (hypothetical protein PRUPE_ppa007067mg [Prunus persica]) HSP 1 Score: 134.0 bits (336), Expect = 1.1e-28 Identity = 60/77 (77.92%), Postives = 66/77 (85.71%), Query Frame = 1
BLAST of MELO3C019477 vs. NCBI nr
Match: gi|802591993|ref|XP_012071337.1| (PREDICTED: uncharacterized protein LOC105633364 isoform X1 [Jatropha curcas]) HSP 1 Score: 134.0 bits (336), Expect = 1.1e-28 Identity = 59/77 (76.62%), Postives = 67/77 (87.01%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|