MELO3C018650 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTAAAGTTGGTGTATACAACACCCAAAAACGTGGCAAATTTTTTGTATTACCTGTTTTCTGTTGGTCGAAACTTTGAACATGAAGGGGATGAGGAATCTCTTGAACTCAAAGAAGGTGATATTGAAGGAGGGTTAGTTCTAAGACGAAAAATATACATTCCGAAGGAAGATGCAAAGATACTGAAGATTAACTCCAGCGTTGTAGCTGTCAAATTAGGTGCTGGTTCTGGTGGATTCTCAAGGTTTGCTCCAAATATTCCTATATGCTACTAGTTTATTCTCAGAGATTTTCATTCATCACTGGAAATATTTCTTTGTTTTTGCAGGTTGGTCTAG ATGTTAAAGTTGGTGTATACAACACCCAAAAACGTGGCAAATTTTTTGTATTACCTGTTTTCTGTTGGTCGAAACTTTGAACATGAAGGGGATGAGGAATCTCTTGAACTCAAAGAAGGTGATATTGAAGGAGGGTTAGTTCTAAGACGAAAAATATACATTCCGAAGGAAGATGCAAAGATACTGAAGATTAACTCCAGCGTTGTAGCTGTCAAATTAGGTGCTGGTTCTGGTGGATTCTCAAGGTTGGTCTAG ATGTTAAAGTTGGTGTATACAACACCCAAAAACGTGGCAAATTTTTTGTATTACCTGTTTTCTGTTGGTCGAAACTTTGAACATGAAGGGGATGAGGAATCTCTTGAACTCAAAGAAGGTGATATTGAAGGAGGGTTAGTTCTAAGACGAAAAATATACATTCCGAAGGAAGATGCAAAGATACTGAAGATTAACTCCAGCGTTGTAGCTGTCAAATTAGGTGCTGGTTCTGGTGGATTCTCAAGGTTGGTCTAG MLKLVYTTPKNVANFLYYLFSVGRNFEHEGDEESLELKEGDIEGGLVLRRKIYIPKEDAKILKINSSVVAVKLGAGSGGFSRLV*
BLAST of MELO3C018650 vs. TrEMBL
Match: A0A0A0L697_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G003980 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 2.6e-22 Identity = 56/63 (88.89%), Postives = 61/63 (96.83%), Query Frame = 1
BLAST of MELO3C018650 vs. TrEMBL
Match: M5WQJ8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000927mg PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.4e-12 Identity = 40/61 (65.57%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of MELO3C018650 vs. TrEMBL
Match: A0A067EPM7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g029749mg PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.9e-12 Identity = 40/70 (57.14%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of MELO3C018650 vs. TrEMBL
Match: B9S1M1_RICCO (Neutral alpha-glucosidase ab, putative OS=Ricinus communis GN=RCOM_0866510 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.2e-12 Identity = 41/63 (65.08%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of MELO3C018650 vs. TrEMBL
Match: V4S2Z8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10011016mg PE=3 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.4e-12 Identity = 38/63 (60.32%), Postives = 52/63 (82.54%), Query Frame = 1
BLAST of MELO3C018650 vs. TAIR10
Match: AT3G23640.1 (AT3G23640.1 heteroglycan glucosidase 1) HSP 1 Score: 73.2 bits (178), Expect = 8.9e-14 Identity = 38/63 (60.32%), Postives = 47/63 (74.60%), Query Frame = 1
BLAST of MELO3C018650 vs. NCBI nr
Match: gi|659095433|ref|XP_008448578.1| (PREDICTED: neutral alpha-glucosidase C [Cucumis melo]) HSP 1 Score: 113.6 bits (283), Expect = 1.7e-22 Identity = 58/63 (92.06%), Postives = 61/63 (96.83%), Query Frame = 1
BLAST of MELO3C018650 vs. NCBI nr
Match: gi|778674835|ref|XP_011650305.1| (PREDICTED: neutral alpha-glucosidase C [Cucumis sativus]) HSP 1 Score: 112.5 bits (280), Expect = 3.7e-22 Identity = 56/63 (88.89%), Postives = 61/63 (96.83%), Query Frame = 1
BLAST of MELO3C018650 vs. NCBI nr
Match: gi|764590476|ref|XP_011465149.1| (PREDICTED: neutral alpha-glucosidase C isoform X3 [Fragaria vesca subsp. vesca]) HSP 1 Score: 81.6 bits (200), Expect = 7.1e-13 Identity = 40/63 (63.49%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of MELO3C018650 vs. NCBI nr
Match: gi|764590471|ref|XP_011465148.1| (PREDICTED: probable glucan 1,3-alpha-glucosidase isoform X2 [Fragaria vesca subsp. vesca]) HSP 1 Score: 81.6 bits (200), Expect = 7.1e-13 Identity = 40/63 (63.49%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of MELO3C018650 vs. NCBI nr
Match: gi|764590467|ref|XP_011465147.1| (PREDICTED: neutral alpha-glucosidase C isoform X1 [Fragaria vesca subsp. vesca]) HSP 1 Score: 81.6 bits (200), Expect = 7.1e-13 Identity = 40/63 (63.49%), Postives = 53/63 (84.13%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|