MELO3C018542 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGCACTCTGTTGGCCCTTATGGTGAGAACTTGGCAACAGCGAACGGCGTGTTAACCACAGCAGCTGCGGTGAACACATGGGCGGCCGAGGAGAAGTACTACAACCATAACTCGAACAAATGTGTGGGAGGCAAGTGCCGACATTATACACAATTGGTGTGGAAGAATAGTTTTTTGGTGGGTTGTGCTACTGTTAAATGCAAGGACAATTGGTCTTCAGTGATCTCATGCAACTATAGTCCTTCTAGGAATGTTGTAGGTGAGCGACCTTATTAA ATGGTGCACTCTGTTGGCCCTTATGGTGAGAACTTGGCAACAGCGAACGGCGTGTTAACCACAGCAGCTGCGGTGAACACATGGGCGGCCGAGGAGAAGTACTACAACCATAACTCGAACAAATGTGTGGGAGGCAAGTGCCGACATTATACACAATTGGTGTGGAAGAATAGTTTTTTGGTGGGTTGTGCTACTGTTAAATGCAAGGACAATTGGTCTTCAGTGATCTCATGCAACTATAGTCCTTCTAGGAATGTTGTAGGTGAGCGACCTTATTAA ATGGTGCACTCTGTTGGCCCTTATGGTGAGAACTTGGCAACAGCGAACGGCGTGTTAACCACAGCAGCTGCGGTGAACACATGGGCGGCCGAGGAGAAGTACTACAACCATAACTCGAACAAATGTGTGGGAGGCAAGTGCCGACATTATACACAATTGGTGTGGAAGAATAGTTTTTTGGTGGGTTGTGCTACTGTTAAATGCAAGGACAATTGGTCTTCAGTGATCTCATGCAACTATAGTCCTTCTAGGAATGTTGTAGGTGAGCGACCTTATTAA MVHSVGPYGENLATANGVLTTAAAVNTWAAEEKYYNHNSNKCVGGKCRHYTQLVWKNSFLVGCATVKCKDNWSSVISCNYSPSRNVVGERPY*
BLAST of MELO3C018542 vs. Swiss-Prot
Match: PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.1e-24 Identity = 49/92 (53.26%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of MELO3C018542 vs. Swiss-Prot
Match: PR1B_TOBAC (Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.2e-23 Identity = 53/94 (56.38%), Postives = 64/94 (68.09%), Query Frame = 1
BLAST of MELO3C018542 vs. Swiss-Prot
Match: PR1C_TOBAC (Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3) HSP 1 Score: 106.3 bits (264), Expect = 1.8e-22 Identity = 51/94 (54.26%), Postives = 63/94 (67.02%), Query Frame = 1
BLAST of MELO3C018542 vs. Swiss-Prot
Match: PRB1_ARATH (Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.4e-22 Identity = 48/92 (52.17%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of MELO3C018542 vs. Swiss-Prot
Match: PR1A_TOBAC (Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.3e-22 Identity = 52/94 (55.32%), Postives = 62/94 (65.96%), Query Frame = 1
BLAST of MELO3C018542 vs. TrEMBL
Match: A0A0A0K4C6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070250 PE=3 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 3.5e-36 Identity = 70/92 (76.09%), Postives = 81/92 (88.04%), Query Frame = 1
BLAST of MELO3C018542 vs. TrEMBL
Match: V7BTC5_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_006G196900g PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 3.5e-28 Identity = 55/92 (59.78%), Postives = 71/92 (77.17%), Query Frame = 1
BLAST of MELO3C018542 vs. TrEMBL
Match: A0A151S107_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_029844 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 2.3e-27 Identity = 55/92 (59.78%), Postives = 70/92 (76.09%), Query Frame = 1
BLAST of MELO3C018542 vs. TrEMBL
Match: B9HN40_POPTR (Pathogenesis-related family protein OS=Populus trichocarpa GN=POPTR_0009s08700g PE=3 SV=2) HSP 1 Score: 127.1 bits (318), Expect = 1.1e-26 Identity = 56/92 (60.87%), Postives = 67/92 (72.83%), Query Frame = 1
BLAST of MELO3C018542 vs. TrEMBL
Match: I3SBC6_MEDTR (CAP, cysteine-rich secretory protein, antigen 5 OS=Medicago truncatula GN=MTR_2g435490 PE=2 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.5e-26 Identity = 56/93 (60.22%), Postives = 70/93 (75.27%), Query Frame = 1
BLAST of MELO3C018542 vs. TAIR10
Match: AT2G14580.1 (AT2G14580.1 basic pathogenesis-related protein 1) HSP 1 Score: 105.9 bits (263), Expect = 1.3e-23 Identity = 48/92 (52.17%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of MELO3C018542 vs. TAIR10
Match: AT2G14610.1 (AT2G14610.1 pathogenesis-related gene 1) HSP 1 Score: 104.4 bits (259), Expect = 3.9e-23 Identity = 47/92 (51.09%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of MELO3C018542 vs. TAIR10
Match: AT4G33730.1 (AT4G33730.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 102.8 bits (255), Expect = 1.1e-22 Identity = 45/90 (50.00%), Postives = 57/90 (63.33%), Query Frame = 1
BLAST of MELO3C018542 vs. TAIR10
Match: AT4G33710.1 (AT4G33710.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 100.5 bits (249), Expect = 5.7e-22 Identity = 51/91 (56.04%), Postives = 59/91 (64.84%), Query Frame = 1
BLAST of MELO3C018542 vs. TAIR10
Match: AT4G25790.1 (AT4G25790.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 99.4 bits (246), Expect = 1.3e-21 Identity = 46/94 (48.94%), Postives = 57/94 (60.64%), Query Frame = 1
BLAST of MELO3C018542 vs. NCBI nr
Match: gi|449438610|ref|XP_004137081.1| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 173.3 bits (438), Expect = 2.0e-40 Identity = 79/92 (85.87%), Postives = 85/92 (92.39%), Query Frame = 1
BLAST of MELO3C018542 vs. NCBI nr
Match: gi|778724761|ref|XP_004137082.2| (PREDICTED: basic form of pathogenesis-related protein 1-like [Cucumis sativus]) HSP 1 Score: 158.7 bits (400), Expect = 5.0e-36 Identity = 70/92 (76.09%), Postives = 81/92 (88.04%), Query Frame = 1
BLAST of MELO3C018542 vs. NCBI nr
Match: gi|659110135|ref|XP_008455067.1| (PREDICTED: pathogenesis-related protein 1A-like [Cucumis melo]) HSP 1 Score: 157.9 bits (398), Expect = 8.5e-36 Identity = 69/92 (75.00%), Postives = 80/92 (86.96%), Query Frame = 1
BLAST of MELO3C018542 vs. NCBI nr
Match: gi|593695605|ref|XP_007148301.1| (hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]) HSP 1 Score: 132.1 bits (331), Expect = 5.0e-28 Identity = 55/92 (59.78%), Postives = 71/92 (77.17%), Query Frame = 1
BLAST of MELO3C018542 vs. NCBI nr
Match: gi|1012337188|gb|KYP48469.1| (hypothetical protein KK1_029844 [Cajanus cajan]) HSP 1 Score: 129.4 bits (324), Expect = 3.2e-27 Identity = 55/92 (59.78%), Postives = 70/92 (76.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |