MELO3C017893 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGATTGATGAGGGAATACCTCCATATATCGCTACTGTTGAGTTGTTGAGGGACCGACTTCTGGGGATAGGGTTCAAGGATCAGGTTGCGATACTTGGTGACAAAATGAAACGAAGCACTTCTTGCTCCATACAAGAGCTTGCAAACGTGATGAGTGGTGGAAAATGTCGCGAGGCTCAGTCGACGTTAAAAAATGAAGAGACGGAGCTTGAAAGTGACTGAAGTATAGAGTGTCAGCCAGAGGCATCTTTGTATACAAAAGATTAAATTACATCAATCTTCCAAATACGGGCTTTTTGTAATTTAGTAACACCTAGAGTAGGGGAGGGATACAGATTTGGATGTTGTTCACCACATAATTTGATTGATTCACGGTGATTTTGCTAAAAATAAAACATTTTGTTTCAAAAG ATGATGATTGATGAGGGAATACCTCCATATATCGCTACTGTTGAGTTGTTGAGGGACCGACTTCTGGGGATAGGGTTCAAGGATCAGGTTGCGATACTTGGTGACAAAATGAAACGAAGCACTTCTTGCTCCATACAAGAGCTTGCAAACGTGATGAGTGGTGGAAAATGTCGCGAGGCTCAGTCGACGTTAAAAAATGAAGAGACGGAGCTTGAAAGTGACTGAAGTATAGAGTGTCAGCCAGAGGCATCTTTGTATACAAAAGATTAAATTACATCAATCTTCCAAATACGGGCTTTTTGTAATTTAGTAACACCTAGAGTAGGGGAGGGATACAGATTTGGATGTTGTTCACCACATAATTTGATTGATTCACGGTGATTTTGCTAAAAATAAAACATTTTGTTTCAAAAG ATGATGATTGATGAGGGAATACCTCCATATATCGCTACTGTTGAGTTGTTGAGGGACCGACTTCTGGGGATAGGGTTCAAGGATCAGGTTGCGATACTTGGTGACAAAATGAAACGAAGCACTTCTTGCTCCATACAAGAGCTTGCAAACGTGATGAGTGGTGGAAAATGTCGCGAGGCTCAGTCGACGTTAAAAAATGAAGAGACGGAGCTTGAAAGTGACTGA MMIDEGIPPYIATVELLRDRLLGIGFKDQVAILGDKMKRSTSCSIQELANVMSGGKCREAQSTLKNEETELESD*
BLAST of MELO3C017893 vs. Swiss-Prot
Match: PPR78_ARATH (Pentatricopeptide repeat-containing protein At1g52640, mitochondrial OS=Arabidopsis thaliana GN=At1g52640 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 4.0e-12 Identity = 39/78 (50.00%), Postives = 52/78 (66.67%), Query Frame = 1
BLAST of MELO3C017893 vs. TrEMBL
Match: A0A0A0KYE8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G004910 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.1e-29 Identity = 70/74 (94.59%), Postives = 71/74 (95.95%), Query Frame = 1
BLAST of MELO3C017893 vs. TrEMBL
Match: A0A0L9V1Q4_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan07g239300 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 8.5e-17 Identity = 48/74 (64.86%), Postives = 60/74 (81.08%), Query Frame = 1
BLAST of MELO3C017893 vs. TrEMBL
Match: A0A0S3RP93_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.03G234600 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 8.5e-17 Identity = 48/74 (64.86%), Postives = 60/74 (81.08%), Query Frame = 1
BLAST of MELO3C017893 vs. TrEMBL
Match: G7L7H7_MEDTR (PPR containing plant-like protein OS=Medicago truncatula GN=MTR_8g102710 PE=4 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.4e-16 Identity = 45/74 (60.81%), Postives = 59/74 (79.73%), Query Frame = 1
BLAST of MELO3C017893 vs. TrEMBL
Match: A0A151SD48_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_025435 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 1.9e-16 Identity = 46/74 (62.16%), Postives = 59/74 (79.73%), Query Frame = 1
BLAST of MELO3C017893 vs. TAIR10
Match: AT1G52640.1 (AT1G52640.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 71.6 bits (174), Expect = 2.3e-13 Identity = 39/78 (50.00%), Postives = 52/78 (66.67%), Query Frame = 1
BLAST of MELO3C017893 vs. NCBI nr
Match: gi|659108995|ref|XP_008454493.1| (PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 3.5e-32 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of MELO3C017893 vs. NCBI nr
Match: gi|449469288|ref|XP_004152353.1| (PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 1.6e-29 Identity = 70/74 (94.59%), Postives = 71/74 (95.95%), Query Frame = 1
BLAST of MELO3C017893 vs. NCBI nr
Match: gi|502138631|ref|XP_004503476.1| (PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Cicer arietinum]) HSP 1 Score: 95.1 bits (235), Expect = 5.4e-17 Identity = 43/74 (58.11%), Postives = 61/74 (82.43%), Query Frame = 1
BLAST of MELO3C017893 vs. NCBI nr
Match: gi|951015529|ref|XP_014510873.1| (PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Vigna radiata var. radiata]) HSP 1 Score: 94.7 bits (234), Expect = 7.1e-17 Identity = 48/74 (64.86%), Postives = 60/74 (81.08%), Query Frame = 1
BLAST of MELO3C017893 vs. NCBI nr
Match: gi|920705464|gb|KOM48689.1| (hypothetical protein LR48_Vigan07g239300 [Vigna angularis]) HSP 1 Score: 94.0 bits (232), Expect = 1.2e-16 Identity = 48/74 (64.86%), Postives = 60/74 (81.08%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |