MELO3C016677 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CTAAAGGAAGCAACTTCCATACTGGACGAGATGATCTTCAAGGGTTATGTGCCTCGTAATGAAAGCATAAACAAACTCGTAGACAGGTTGTGCCAGGAATGCAATATGGAGCTGTTGTGGATGGTCTTAAACAGTCTGGGAAGAGGAAATCGCATGAATATGGACACGTGGGCTAGAGTTGTTGCTTTTCTTTACAAGGAGAACCTATTGGAATCCTCCAACTTAATTGACTCATTGATCAGTTGA CTAAAGGAAGCAACTTCCATACTGGACGAGATGATCTTCAAGGGTTATGTGCCTCGTAATGAAAGCATAAACAAACTCGTAGACAGGTTGTGCCAGGAATGCAATATGGAGCTGTTGTGGATGGTCTTAAACAGTCTGGGAAGAGGAAATCGCATGAATATGGACACGTGGGCTAGAGTTGTTGCTTTTCTTTACAAGGAGAACCTATTGGAATCCTCCAACTTAATTGACTCATTGATCAGTTGA CTAAAGGAAGCAACTTCCATACTGGACGAGATGATCTTCAAGGGTTATGTGCCTCGTAATGAAAGCATAAACAAACTCGTAGACAGGTTGTGCCAGGAATGCAATATGGAGCTGTTGTGGATGGTCTTAAACAGTCTGGGAAGAGGAAATCGCATGAATATGGACACGTGGGCTAGAGTTGTTGCTTTTCTTTACAAGGAGAACCTATTGGAATCCTCCAACTTAATTGACTCATTGATCAGTTGA LKEATSILDEMIFKGYVPRNESINKLVDRLCQECNMELLWMVLNSLGRGNRMNMDTWARVVAFLYKENLLESSNLIDSLIS*
BLAST of MELO3C016677 vs. Swiss-Prot
Match: PPR79_ARATH (Putative pentatricopeptide repeat-containing protein At1g53330 OS=Arabidopsis thaliana GN=At1g53330 PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 1.7e-08 Identity = 30/80 (37.50%), Postives = 48/80 (60.00%), Query Frame = 1
BLAST of MELO3C016677 vs. TrEMBL
Match: A0A0A0KZF4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G622790 PE=4 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 4.0e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 1
BLAST of MELO3C016677 vs. TrEMBL
Match: A0A061G0T6_THECC (Pentatricopeptide repeat (PPR) superfamily protein, putative OS=Theobroma cacao GN=TCM_014871 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-15 Identity = 44/80 (55.00%), Postives = 61/80 (76.25%), Query Frame = 1
BLAST of MELO3C016677 vs. TrEMBL
Match: A0A067KII7_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_10578 PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.5e-14 Identity = 44/80 (55.00%), Postives = 57/80 (71.25%), Query Frame = 1
BLAST of MELO3C016677 vs. TrEMBL
Match: A0A061F7L0_THECC (Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 OS=Theobroma cacao GN=TCM_031884 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 3.3e-14 Identity = 43/80 (53.75%), Postives = 60/80 (75.00%), Query Frame = 1
BLAST of MELO3C016677 vs. TrEMBL
Match: A0A061F8G6_THECC (Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 2 OS=Theobroma cacao GN=TCM_031884 PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 3.3e-14 Identity = 43/80 (53.75%), Postives = 60/80 (75.00%), Query Frame = 1
BLAST of MELO3C016677 vs. TAIR10
Match: AT1G53330.1 (AT1G53330.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 59.7 bits (143), Expect = 9.8e-10 Identity = 30/80 (37.50%), Postives = 48/80 (60.00%), Query Frame = 1
BLAST of MELO3C016677 vs. NCBI nr
Match: gi|659103014|ref|XP_008452430.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At1g53330 [Cucumis melo]) HSP 1 Score: 164.5 bits (415), Expect = 8.0e-38 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 1
BLAST of MELO3C016677 vs. NCBI nr
Match: gi|659103014|ref|XP_008452430.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At1g53330 [Cucumis melo]) HSP 1 Score: 30.8 bits (68), Expect = 1.4e+03 Identity = 15/48 (31.25%), Postives = 26/48 (54.17%), Query Frame = 1
HSP 2 Score: 158.3 bits (399), Expect = 5.7e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 1
BLAST of MELO3C016677 vs. NCBI nr
Match: gi|449456681|ref|XP_004146077.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At1g53330 [Cucumis sativus]) HSP 1 Score: 158.3 bits (399), Expect = 5.7e-36 Identity = 77/81 (95.06%), Postives = 79/81 (97.53%), Query Frame = 1
BLAST of MELO3C016677 vs. NCBI nr
Match: gi|590671365|ref|XP_007038311.1| (Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao]) HSP 1 Score: 90.1 bits (222), Expect = 1.9e-15 Identity = 44/80 (55.00%), Postives = 61/80 (76.25%), Query Frame = 1
BLAST of MELO3C016677 vs. NCBI nr
Match: gi|643725951|gb|KDP34798.1| (hypothetical protein JCGZ_10578 [Jatropha curcas]) HSP 1 Score: 86.7 bits (213), Expect = 2.1e-14 Identity = 44/80 (55.00%), Postives = 57/80 (71.25%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|