MELO3C013490 (gene) Melon (DHL92) v3.5.1

NameMELO3C013490
Typegene
OrganismCucumis melo (Melon (DHL92) v3.5.1)
Descriptionpyruvate decarboxylase-3
Locationchr11 : 15022013 .. 15022339 (-)
The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDS
Hold the cursor over a type above to highlight its positions in the sequence below.
ATGTTACCCCCGACGGCAGGCGATCAAATAAAATTTGGCGGCTGGGATGAACGACGAAAGGACTTCGCACACGTGTGGCTTGCAGATCTCAGCGGCAGAGCATCACGAACGATGGCAAGAACTGCAGCGAAAACTATCGCTCTGATGGCCTCGAACGGCGGCGTGTGGGTGGAAATCACCGGCGAGTTAAGAGGCGCAAGGGGTGGCTGTGTGGTGGCGTCGGCTGAAGGAGAAGAAGAGAGGAGTTTCGGGCGTATTGTCGACGACAAGGCGCGTCGTCCCCGGCGTGCGTGGGAGAGGTACGGGCGGGTGTGTCGTCGTCGGTAG

mRNA sequence

ATGTTACCCCCGACGGCAGGCGATCAAATAAAATTTGGCGGCTGGGATGAACGACGAAAGGACTTCGCACACGTGTGGCTTGCAGATCTCAGCGGCAGAGCATCACGAACGATGGCAAGAACTGCAGCGAAAACTATCGCTCTGATGGCCTCGAACGGCGGCGTGTGGGTGGAAATCACCGGCGAGTTAAGAGGCGCAAGGGGTGGCTGTGTGGTGGCGTCGGCTGAAGGAGAAGAAGAGAGGAGTTTCGGGCGTATTGTCGACGACAAGGCGCGTCGTCCCCGGCGTGCGTGGGAGAGGTACGGGCGGGTGTGTCGTCGTCGGTAG

Coding sequence (CDS)

ATGTTACCCCCGACGGCAGGCGATCAAATAAAATTTGGCGGCTGGGATGAACGACGAAAGGACTTCGCACACGTGTGGCTTGCAGATCTCAGCGGCAGAGCATCACGAACGATGGCAAGAACTGCAGCGAAAACTATCGCTCTGATGGCCTCGAACGGCGGCGTGTGGGTGGAAATCACCGGCGAGTTAAGAGGCGCAAGGGGTGGCTGTGTGGTGGCGTCGGCTGAAGGAGAAGAAGAGAGGAGTTTCGGGCGTATTGTCGACGACAAGGCGCGTCGTCCCCGGCGTGCGTGGGAGAGGTACGGGCGGGTGTGTCGTCGTCGGTAG

Protein sequence

MLPPTAGDQIKFGGWDERRKDFAHVWLADLSGRASRTMARTAAKTIALMASNGGVWVEITGELRGARGGCVVASAEGEEERSFGRIVDDKARRPRRAWERYGRVCRRR*
GO Assignments
This gene is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0008150 biological_process
cellular_component GO:0005575 cellular_component
molecular_function GO:0003674 molecular_function
This gene is associated with the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
MU51681melon EST collection version 4.0transcribed_cluster

The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameType
MELO3C013490T1MELO3C013490T1mRNA


The following transcribed_cluster feature(s) are associated with this gene:

Feature NameUnique NameType
MU51681MU51681transcribed_cluster


The following gene(s) are orthologous to this gene:

None

The following gene(s) are paralogous to this gene:

None

The following block(s) are covering this gene:
GeneOrganismBlock
MELO3C013490Wax gourdmewgoB107
MELO3C013490Wax gourdmewgoB112
MELO3C013490Wax gourdmewgoB126
MELO3C013490Cucumber (Gy14) v1cgymeB119
MELO3C013490Cucumber (Gy14) v1cgymeB179
MELO3C013490Cucurbita maxima (Rimu)cmameB085
MELO3C013490Cucurbita maxima (Rimu)cmameB451
MELO3C013490Cucurbita maxima (Rimu)cmameB494
MELO3C013490Cucurbita maxima (Rimu)cmameB553
MELO3C013490Cucurbita moschata (Rifu)cmomeB081
MELO3C013490Cucurbita moschata (Rifu)cmomeB443
MELO3C013490Cucurbita moschata (Rifu)cmomeB482
MELO3C013490Cucurbita moschata (Rifu)cmomeB542
MELO3C013490Wild cucumber (PI 183967)cpimeB419
MELO3C013490Cucumber (Chinese Long) v2cumeB425
MELO3C013490Cucumber (Chinese Long) v2cumeB517
MELO3C013490Watermelon (Charleston Gray)mewcgB092
MELO3C013490Watermelon (Charleston Gray)mewcgB112
MELO3C013490Watermelon (97103) v1mewmB110
MELO3C013490Cucurbita pepo (Zucchini)cpemeB213
MELO3C013490Cucurbita pepo (Zucchini)cpemeB257
MELO3C013490Cucurbita pepo (Zucchini)cpemeB601
MELO3C013490Cucurbita pepo (Zucchini)cpemeB659
MELO3C013490Bottle gourd (USVL1VR-Ls)lsimeB053
MELO3C013490Bottle gourd (USVL1VR-Ls)lsimeB088
MELO3C013490Cucumber (Gy14) v2cgybmeB367
MELO3C013490Cucumber (Gy14) v2cgybmeB454
MELO3C013490Silver-seed gourdcarmeB0197
MELO3C013490Silver-seed gourdcarmeB0350
MELO3C013490Silver-seed gourdcarmeB0843
MELO3C013490Silver-seed gourdcarmeB1032
MELO3C013490Cucumber (Chinese Long) v3cucmeB431
MELO3C013490Cucumber (Chinese Long) v3cucmeB534
MELO3C013490Watermelon (97103) v2mewmbB094
MELO3C013490Watermelon (97103) v2mewmbB114