MELO3C013394 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.AAGAGTCTTTCCATATTCGAAATCTTGAAAGAAATTTAGAAGTTTTGTATTCCTTTCAAGGTCTCATATTTCAAATCTTGGAACATATCACAACATGGGTTTCCGTTTGCCTCGAATTGTTACTGCTAAGCAAAGTCTTCAACGATCTTCATCAAAAGAAAATGGAACATCTCCGAAAATTGTTGATGTTCCTAAGGGCTATTTTAGTGTTTATGTCGGTGAGGAACATAAGAAGCGTTTTGTCATCCCACTATCTTACTTAAACCAGCCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCCATGAAGACGAGTTCCTTGATCTCACTCGGAGTTTGAATGAATCATAAAGTAGAGATGAACATTTAGGAATGGATAGTGTAAAGAAAATGAATTAGAGTGTAGAAACAATG AAGAGTCTTTCCATATTCGAAATCTTGAAAGAAATTTAGAAGTTTTGTATTCCTTTCAAGGTCTCATATTTCAAATCTTGGAACATATCACAACATGGGTTTCCGTTTGCCTCGAATTGTTACTGCTAAGCAAAGTCTTCAACGATCTTCATCAAAAGAAAATGGAACATCTCCGAAAATTGTTGATGTTCCTAAGGGCTATTTTAGTGTTTATGTCGGTGAGGAACATAAGAAGCGTTTTGTCATCCCACTATCTTACTTAAACCAGCCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCCATGAAGACGAGTTCCTTGATCTCACTCGGAGTTTGAATGAATCATAAAGTAGAGATGAACATTTAGGAATGGATAGTGTAAAGAAAATGAATTAGAGTGTAGAAACAATG ATGGGTTTCCGTTTGCCTCGAATTGTTACTGCTAAGCAAAGTCTTCAACGATCTTCATCAAAAGAAAATGGAACATCTCCGAAAATTGTTGATGTTCCTAAGGGCTATTTTAGTGTTTATGTCGGTGAGGAACATAAGAAGCGTTTTGTCATCCCACTATCTTACTTAAACCAGCCTTCTTTTCAAGATTTGTTGAGTCAAGCAGAAGAAGAATTTGGATATAATCATCCAATGGGTGGCATCACAATTCCTTGCCATGAAGACGAGTTCCTTGATCTCACTCGGAGTTTGAATGAATCATAA MGFRLPRIVTAKQSLQRSSSKENGTSPKIVDVPKGYFSVYVGEEHKKRFVIPLSYLNQPSFQDLLSQAEEEFGYNHPMGGITIPCHEDEFLDLTRSLNES*
BLAST of MELO3C013394 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.1e-27 Identity = 62/99 (62.63%), Postives = 74/99 (74.75%), Query Frame = 1
BLAST of MELO3C013394 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 5.1e-26 Identity = 60/99 (60.61%), Postives = 74/99 (74.75%), Query Frame = 1
BLAST of MELO3C013394 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 6.6e-26 Identity = 60/98 (61.22%), Postives = 71/98 (72.45%), Query Frame = 1
BLAST of MELO3C013394 vs. Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.5e-25 Identity = 61/98 (62.24%), Postives = 70/98 (71.43%), Query Frame = 1
BLAST of MELO3C013394 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.2e-24 Identity = 61/98 (62.24%), Postives = 65/98 (66.33%), Query Frame = 1
BLAST of MELO3C013394 vs. TrEMBL
Match: A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 196.1 bits (497), Expect = 2.1e-47 Identity = 94/100 (94.00%), Postives = 97/100 (97.00%), Query Frame = 1
BLAST of MELO3C013394 vs. TrEMBL
Match: A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 1.9e-43 Identity = 89/100 (89.00%), Postives = 93/100 (93.00%), Query Frame = 1
BLAST of MELO3C013394 vs. TrEMBL
Match: A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 4.6e-42 Identity = 87/100 (87.00%), Postives = 91/100 (91.00%), Query Frame = 1
BLAST of MELO3C013394 vs. TrEMBL
Match: A0A0A0K0H6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008960 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 9.6e-40 Identity = 85/102 (83.33%), Postives = 90/102 (88.24%), Query Frame = 1
BLAST of MELO3C013394 vs. TrEMBL
Match: A0A0A0K0H9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009010 PE=4 SV=1) HSP 1 Score: 167.5 bits (423), Expect = 8.1e-39 Identity = 82/99 (82.83%), Postives = 87/99 (87.88%), Query Frame = 1
BLAST of MELO3C013394 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 121.7 bits (304), Expect = 2.6e-28 Identity = 55/99 (55.56%), Postives = 76/99 (76.77%), Query Frame = 1
BLAST of MELO3C013394 vs. TAIR10
Match: AT4G34800.1 (AT4G34800.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.5 bits (267), Expect = 5.0e-24 Identity = 54/98 (55.10%), Postives = 67/98 (68.37%), Query Frame = 1
BLAST of MELO3C013394 vs. TAIR10
Match: AT5G18050.1 (AT5G18050.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 107.5 bits (267), Expect = 5.0e-24 Identity = 49/90 (54.44%), Postives = 67/90 (74.44%), Query Frame = 1
BLAST of MELO3C013394 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.5 bits (262), Expect = 1.9e-23 Identity = 49/91 (53.85%), Postives = 67/91 (73.63%), Query Frame = 1
BLAST of MELO3C013394 vs. TAIR10
Match: AT4G34770.1 (AT4G34770.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 104.4 bits (259), Expect = 4.3e-23 Identity = 59/108 (54.63%), Postives = 71/108 (65.74%), Query Frame = 1
BLAST of MELO3C013394 vs. NCBI nr
Match: gi|659094356|ref|XP_008448016.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 206.1 bits (523), Expect = 3.0e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
BLAST of MELO3C013394 vs. NCBI nr
Match: gi|778722830|ref|XP_004144905.2| (PREDICTED: auxin-induced protein X10A-like [Cucumis sativus]) HSP 1 Score: 196.1 bits (497), Expect = 3.1e-47 Identity = 94/100 (94.00%), Postives = 97/100 (97.00%), Query Frame = 1
BLAST of MELO3C013394 vs. NCBI nr
Match: gi|778722823|ref|XP_011658575.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 183.0 bits (463), Expect = 2.7e-43 Identity = 89/100 (89.00%), Postives = 93/100 (93.00%), Query Frame = 1
BLAST of MELO3C013394 vs. NCBI nr
Match: gi|778722820|ref|XP_011658574.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 178.3 bits (451), Expect = 6.6e-42 Identity = 87/100 (87.00%), Postives = 91/100 (91.00%), Query Frame = 1
BLAST of MELO3C013394 vs. NCBI nr
Match: gi|659094352|ref|XP_008448014.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 178.3 bits (451), Expect = 6.6e-42 Identity = 85/100 (85.00%), Postives = 91/100 (91.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |