MELO3C011381 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGATGTTTGTTTTCAATACGATGAAAAAGCTGTCATAAGAGAGAAGTTTAACTTTGGGCAATTTCCGATAATGCTGAAGGTTTGTTTTTCGTGGCTTAGTTTCGTTTGTTTATGTTGGCTCTATAATTCTGTTACTGAATGATGGCATCTTTGTTCTTTTCCTTTGTTAAATTGTTATACTTAAAAACTGGAAGGCTTTTTTCTGTGATAGTCTTTTTTGGGAGGCTCTCTCTACTCATTGTACTTAAGTTGTTTTCCTTTGTCCAATATGAATATAGTTTTCACTTGTTTCATATAAAACAAGAGAATATGATCTTCAATTATTTTTCCCCATGTAGAAGGAACTCTATAGTTGCTTATGTCTATTGGAATGTGATTTTTTAAAAGAATAGAAACAGGTAGAAAGCCGCAAACAAGTGCATCAACAAACAAGTGCCTGGGATTTCTTAAAACTCGGGTAATCTTTGTTTCCCTAGTTTTGCCTGGCCATTGATCTACTTTCTGTATTTTTGCTCAGTCAAAGCTTTGTCACTTGAGAGGTCTTGATCCCAAGAAGTTGGTCTCCTACAACGAAGAGGCATCAGAAATGGGTGGGTAA ATGGCAGATGTTTGTTTTCAATACGATGAAAAAGCTGTCATAAGAGAGAAGTTTAACTTTGGGCAATTTCCGATAATGCTGAAGTCAAAGCTTTGTCACTTGAGAGGTCTTGATCCCAAGAAGTTGGTCTCCTACAACGAAGAGGCATCAGAAATGGGTGGGTAA ATGGCAGATGTTTGTTTTCAATACGATGAAAAAGCTGTCATAAGAGAGAAGTTTAACTTTGGGCAATTTCCGATAATGCTGAAGTCAAAGCTTTGTCACTTGAGAGGTCTTGATCCCAAGAAGTTGGTCTCCTACAACGAAGAGGCATCAGAAATGGGTGGGTAA MADVCFQYDEKAVIREKFNFGQFPIMLKSKLCHLRGLDPKKLVSYNEEASEMGG*
BLAST of MELO3C011381 vs. Swiss-Prot
Match: NRPA2_ARATH (DNA-directed RNA polymerase I subunit 2 OS=Arabidopsis thaliana GN=NRPA2 PE=2 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 9.2e-14 Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 1
BLAST of MELO3C011381 vs. TrEMBL
Match: A0A0A0KIZ8_CUCSA (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus GN=Csa_6G400300 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 3.4e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of MELO3C011381 vs. TrEMBL
Match: A0A068UJY6_COFCA (DNA-directed RNA polymerase subunit beta OS=Coffea canephora GN=GSCOC_T00025459001 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.0e-16 Identity = 43/54 (79.63%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of MELO3C011381 vs. TrEMBL
Match: A5C2Y6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_038847 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 5.3e-16 Identity = 42/54 (77.78%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of MELO3C011381 vs. TrEMBL
Match: A0A0S3S909_PHAAN (DNA-directed RNA polymerase subunit beta OS=Vigna angularis var. angularis GN=Vigan.06G026200 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 6.9e-16 Identity = 42/52 (80.77%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of MELO3C011381 vs. TrEMBL
Match: F6HVC4_VITVI (DNA-directed RNA polymerase subunit beta OS=Vitis vinifera GN=VIT_13s0084g00600 PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 6.9e-16 Identity = 42/54 (77.78%), Postives = 45/54 (83.33%), Query Frame = 1
BLAST of MELO3C011381 vs. TAIR10
Match: AT1G29940.1 (AT1G29940.1 nuclear RNA polymerase A2) HSP 1 Score: 76.6 bits (187), Expect = 5.2e-15 Identity = 34/54 (62.96%), Postives = 41/54 (75.93%), Query Frame = 1
BLAST of MELO3C011381 vs. NCBI nr
Match: gi|449458081|ref|XP_004146776.1| (PREDICTED: DNA-directed RNA polymerase I subunit RPA2 [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 4.9e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of MELO3C011381 vs. NCBI nr
Match: gi|700192552|gb|KGN47756.1| (hypothetical protein Csa_6G400300 [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 4.9e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of MELO3C011381 vs. NCBI nr
Match: gi|659089195|ref|XP_008445376.1| (PREDICTED: DNA-directed RNA polymerase I subunit RPA2 [Cucumis melo]) HSP 1 Score: 114.8 bits (286), Expect = 4.9e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of MELO3C011381 vs. NCBI nr
Match: gi|720071825|ref|XP_010278175.1| (PREDICTED: DNA-directed RNA polymerase I subunit RPA2 [Nelumbo nucifera]) HSP 1 Score: 92.0 bits (227), Expect = 3.4e-16 Identity = 41/54 (75.93%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of MELO3C011381 vs. NCBI nr
Match: gi|661888437|emb|CDP07938.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 91.3 bits (225), Expect = 5.8e-16 Identity = 43/54 (79.63%), Postives = 46/54 (85.19%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|