MELO3C010561 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAAGAGCAAAGACGATATAACATACGGTGCTGCTCAAGCTAAATTATCCGAAGACGAAGCCCTAAGAGTCGCCTACAAGCACGGTACGCCGCTTGAATCTGGGAAAATTTCGGACTCCGATACTGTCGATCTTTTTTCCAGTGCACACAAAATTGCTCAAGATACTTCTGGCGCTCGTTCTTCCGCGGCCGCTGCTCAATCGATTTCATCCAATCAGGTGCATCGCGGTGGCGATGCTAATGATGAAGAAGCTGGAACGGGATGTGATACTGCCGATCCTTCCGCCGGGCGCCGGTTCGGTTGA ATGGCGAAGAGCAAAGACGATATAACATACGGTGCTGCTCAAGCTAAATTATCCGAAGACGAAGCCCTAAGAGTCGCCTACAAGCACGGTACGCCGCTTGAATCTGGGAAAATTTCGGACTCCGATACTGTCGATCTTTTTTCCAGTGCACACAAAATTGCTCAAGATACTTCTGGCGCTCGTTCTTCCGCGGCCGCTGCTCAATCGATTTCATCCAATCAGGTGCATCGCGGTGGCGATGCTAATGATGAAGAAGCTGGAACGGGATGTGATACTGCCGATCCTTCCGCCGGGCGCCGGTTCGGTTGA ATGGCGAAGAGCAAAGACGATATAACATACGGTGCTGCTCAAGCTAAATTATCCGAAGACGAAGCCCTAAGAGTCGCCTACAAGCACGGTACGCCGCTTGAATCTGGGAAAATTTCGGACTCCGATACTGTCGATCTTTTTTCCAGTGCACACAAAATTGCTCAAGATACTTCTGGCGCTCGTTCTTCCGCGGCCGCTGCTCAATCGATTTCATCCAATCAGGTGCATCGCGGTGGCGATGCTAATGATGAAGAAGCTGGAACGGGATGTGATACTGCCGATCCTTCCGCCGGGCGCCGGTTCGGTTGA MAKSKDDITYGAAQAKLSEDEALRVAYKHGTPLESGKISDSDTVDLFSSAHKIAQDTSGARSSAAAAQSISSNQVHRGGDANDEEAGTGCDTADPSAGRRFG*
BLAST of MELO3C010561 vs. TrEMBL
Match: E5GBB4_CUCME (Seed maturation protein OS=Cucumis melo subsp. melo PE=4 SV=1) HSP 1 Score: 202.6 bits (514), Expect = 2.3e-49 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C010561 vs. TrEMBL
Match: A0A067JQL1_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22663 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.6e-18 Identity = 53/91 (58.24%), Postives = 63/91 (69.23%), Query Frame = 1
BLAST of MELO3C010561 vs. TrEMBL
Match: B9RI57_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1576520 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 4.7e-18 Identity = 52/92 (56.52%), Postives = 67/92 (72.83%), Query Frame = 1
BLAST of MELO3C010561 vs. TrEMBL
Match: A0A072VAH4_MEDTR (Seed maturation protein OS=Medicago truncatula GN=MTR_2g069650 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 1.2e-16 Identity = 49/91 (53.85%), Postives = 60/91 (65.93%), Query Frame = 1
BLAST of MELO3C010561 vs. TrEMBL
Match: V4T275_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10023629mg PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.5e-16 Identity = 51/88 (57.95%), Postives = 62/88 (70.45%), Query Frame = 1
BLAST of MELO3C010561 vs. TAIR10
Match: AT3G12960.1 (AT3G12960.1 unknown protein) HSP 1 Score: 84.7 bits (208), Expect = 3.6e-17 Identity = 43/66 (65.15%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of MELO3C010561 vs. NCBI nr
Match: gi|659087135|ref|XP_008444288.1| (PREDICTED: uncharacterized protein LOC103487654 [Cucumis melo]) HSP 1 Score: 202.6 bits (514), Expect = 3.3e-49 Identity = 102/102 (100.00%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of MELO3C010561 vs. NCBI nr
Match: gi|1009129821|ref|XP_015881974.1| (PREDICTED: uncharacterized protein LOC107417839 [Ziziphus jujuba]) HSP 1 Score: 99.4 bits (246), Expect = 4.0e-18 Identity = 48/87 (55.17%), Postives = 64/87 (73.56%), Query Frame = 1
BLAST of MELO3C010561 vs. NCBI nr
Match: gi|802743943|ref|XP_012087428.1| (PREDICTED: uncharacterized protein LOC105646223 [Jatropha curcas]) HSP 1 Score: 99.0 bits (245), Expect = 5.2e-18 Identity = 53/91 (58.24%), Postives = 63/91 (69.23%), Query Frame = 1
BLAST of MELO3C010561 vs. NCBI nr
Match: gi|255544730|ref|XP_002513426.1| (PREDICTED: uncharacterized protein LOC8272645 [Ricinus communis]) HSP 1 Score: 98.6 bits (244), Expect = 6.8e-18 Identity = 52/92 (56.52%), Postives = 67/92 (72.83%), Query Frame = 1
BLAST of MELO3C010561 vs. NCBI nr
Match: gi|922391812|ref|XP_013464318.1| (seed maturation protein [Medicago truncatula]) HSP 1 Score: 94.0 bits (232), Expect = 1.7e-16 Identity = 49/91 (53.85%), Postives = 60/91 (65.93%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|