MELO3C010391.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAGATTGTCAATAACAAGTCTATGTGTTTTGGTGGCTGTGGTGGAGACGATGGCGCTTCTAAGTGGAGCTCCTTCGGTCAATGCAGTGGAATGCATTCCTCAGGAGCTGACCCCGTGTATTGATGCAATTAAATCCTCGTCGGTGGCGCCGTCGAGCATTTGCTGCATGAAGATGGAAGAGCAGGCGCCGTGCCTATGCCAATACGCTAAGATTCCAAGCTTCAAGCCTTTAATTGCCGGCGGGCAACGGGTTGCCGCTGTTTGCGGCGTCACCCTTCCAGTGTGTTAA ATGATGAGATTGTCAATAACAAGTCTATGTGTTTTGGTGGCTGTGGTGGAGACGATGGCGCTTCTAAGTGGAGCTCCTTCGGTCAATGCAGTGGAATGCATTCCTCAGGAGCTGACCCCGTGTATTGATGCAATTAAATCCTCGTCGGTGGCGCCGTCGAGCATTTGCTGCATGAAGATGGAAGAGCAGGCGCCGTGCCTATGCCAATACGCTAAGATTCCAAGCTTCAAGCCTTTAATTGCCGGCGGGCAACGGGTTGCCGCTGTTTGCGGCGTCACCCTTCCAGTGTGTTAA ATGATGAGATTGTCAATAACAAGTCTATGTGTTTTGGTGGCTGTGGTGGAGACGATGGCGCTTCTAAGTGGAGCTCCTTCGGTCAATGCAGTGGAATGCATTCCTCAGGAGCTGACCCCGTGTATTGATGCAATTAAATCCTCGTCGGTGGCGCCGTCGAGCATTTGCTGCATGAAGATGGAAGAGCAGGCGCCGTGCCTATGCCAATACGCTAAGATTCCAAGCTTCAAGCCTTTAATTGCCGGCGGGCAACGGGTTGCCGCTGTTTGCGGCGTCACCCTTCCAGTGTGTTAA MMRLSITSLCVLVAVVETMALLSGAPSVNAVECIPQELTPCIDAIKSSSVAPSSICCMKMEEQAPCLCQYAKIPSFKPLIAGGQRVAAVCGVTLPVC
BLAST of MELO3C010391.2 vs. NCBI nr
Match: KGN53811.1 (hypothetical protein Csa_4G135200 [Cucumis sativus]) HSP 1 Score: 177.9 bits (450), Expect = 1.6e-41 Identity = 92/97 (94.85%), Postives = 94/97 (96.91%), Query Frame = 0
BLAST of MELO3C010391.2 vs. NCBI nr
Match: XP_022955891.1 (non-specific lipid-transfer protein 2-like [Cucurbita moschata]) HSP 1 Score: 121.3 bits (303), Expect = 1.8e-24 Identity = 62/97 (63.92%), Postives = 74/97 (76.29%), Query Frame = 0
BLAST of MELO3C010391.2 vs. NCBI nr
Match: XP_023527040.1 (non-specific lipid-transfer protein 2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 118.2 bits (295), Expect = 1.5e-23 Identity = 60/97 (61.86%), Postives = 73/97 (75.26%), Query Frame = 0
BLAST of MELO3C010391.2 vs. NCBI nr
Match: XP_022158506.1 (non-specific lipid-transfer protein 2-like [Momordica charantia]) HSP 1 Score: 91.7 bits (226), Expect = 1.5e-15 Identity = 49/99 (49.49%), Postives = 68/99 (68.69%), Query Frame = 0
BLAST of MELO3C010391.2 vs. NCBI nr
Match: XP_009398150.1 (PREDICTED: non-specific lipid-transfer protein 2-like [Musa acuminata subsp. malaccensis]) HSP 1 Score: 87.4 bits (215), Expect = 2.9e-14 Identity = 48/96 (50.00%), Postives = 60/96 (62.50%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TAIR10
Match: AT2G14846.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 58.2 bits (139), Expect = 3.4e-09 Identity = 33/89 (37.08%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TAIR10
Match: AT1G43667.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 52.4 bits (124), Expect = 1.8e-07 Identity = 24/67 (35.82%), Postives = 35/67 (52.24%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TAIR10
Match: AT1G66850.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 52.0 bits (123), Expect = 2.4e-07 Identity = 27/69 (39.13%), Postives = 36/69 (52.17%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TAIR10
Match: AT1G73780.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 50.4 bits (119), Expect = 7.0e-07 Identity = 32/99 (32.32%), Postives = 51/99 (51.52%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TAIR10
Match: AT1G07747.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 50.4 bits (119), Expect = 7.0e-07 Identity = 28/96 (29.17%), Postives = 48/96 (50.00%), Query Frame = 0
BLAST of MELO3C010391.2 vs. Swiss-Prot
Match: sp|P82353|NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.6e-08 Identity = 28/69 (40.58%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of MELO3C010391.2 vs. Swiss-Prot
Match: sp|Q43681|NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 2.2e-05 Identity = 30/79 (37.97%), Postives = 35/79 (44.30%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TrEMBL
Match: tr|A0A0A0L0Z5|A0A0A0L0Z5_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G135200 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 1.1e-41 Identity = 92/97 (94.85%), Postives = 94/97 (96.91%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TrEMBL
Match: tr|A0A0L9T474|A0A0L9T474_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan102s004000 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 6.7e-12 Identity = 42/89 (47.19%), Postives = 54/89 (60.67%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TrEMBL
Match: tr|A0A0S3T6S1|A0A0S3T6S1_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.11G005300 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 6.7e-12 Identity = 42/89 (47.19%), Postives = 54/89 (60.67%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TrEMBL
Match: tr|A0A151TDA0|A0A151TDA0_CAJCA (Putative non-specific lipid-transfer protein AKCS9 OS=Cajanus cajan OX=3821 GN=KK1_019631 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 6.7e-12 Identity = 40/89 (44.94%), Postives = 56/89 (62.92%), Query Frame = 0
BLAST of MELO3C010391.2 vs. TrEMBL
Match: tr|A0A068TST2|A0A068TST2_COFCA (Uncharacterized protein OS=Coffea canephora OX=49390 GN=GSCOC_T00022490001 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 2.0e-11 Identity = 44/87 (50.57%), Postives = 52/87 (59.77%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|