MELO3C008034 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.AGGAAAAAGAAGGCAGAGTAAAACAAAAAAAAAAAAACCACAACAAATCAAACATATCACCACCACTCCAAAATGAGATCAATGAAGCTCGGCCTATTTCTCCTCGTCATCGCAGTCGTCGCCGCTCCACTTTGCCTTGCCTTCTCCGACGACTGGACTCACGCCTATGCTGCCCCCAACTACGACTTTACGACGAATAATGAAGACAGCCGACGGCTACTTTTCCAATATGGATTTGCTTATAAATATCCAAAAAATAAGTATTTGGGGTATGATGCACTTAGGAAGAATAATTCCCCCTGCCGCCATCGTGGTAGATCTTACTACGACTGTAAGAAGCGTAGGAAGGCCAACCCTTACCGTCGTGGCTGCATTGCCATCACCGGCTGCGCTCGTTTCACCGATTAAATTGTTTTAAGAAAAAATGATCTGTGTTGAGATTG AGGAAAAAGAAGGCAGAGTAAAACAAAAAAAAAAAAACCACAACAAATCAAACATATCACCACCACTCCAAAATGAGATCAATGAAGCTCGGCCTATTTCTCCTCGTCATCGCAGTCGTCGCCGCTCCACTTTGCCTTGCCTTCTCCGACGACTGGACTCACGCCTATGCTGCCCCCAACTACGACTTTACGACGAATAATGAAGACAGCCGACGGCTACTTTTCCAATATGGATTTGCTTATAAATATCCAAAAAATAAGTATTTGGGGTATGATGCACTTAGGAAGAATAATTCCCCCTGCCGCCATCGTGGTAGATCTTACTACGACTGTAAGAAGCGTAGGAAGGCCAACCCTTACCGTCGTGGCTGCATTGCCATCACCGGCTGCGCTCGTTTCACCGATTAAATTGTTTTAAGAAAAAATGATCTGTGTTGAGATTG ATGAGATCAATGAAGCTCGGCCTATTTCTCCTCGTCATCGCAGTCGTCGCCGCTCCACTTTGCCTTGCCTTCTCCGACGACTGGACTCACGCCTATGCTGCCCCCAACTACGACTTTACGACGAATAATGAAGACAGCCGACGGCTACTTTTCCAATATGGATTTGCTTATAAATATCCAAAAAATAAGTATTTGGGGTATGATGCACTTAGGAAGAATAATTCCCCCTGCCGCCATCGTGGTAGATCTTACTACGACTGTAAGAAGCGTAGGAAGGCCAACCCTTACCGTCGTGGCTGCATTGCCATCACCGGCTGCGCTCGTTTCACCGATTAA MRSMKLGLFLLVIAVVAAPLCLAFSDDWTHAYAAPNYDFTTNNEDSRRLLFQYGFAYKYPKNKYLGYDALRKNNSPCRHRGRSYYDCKKRRKANPYRRGCIAITGCARFTD*
BLAST of MELO3C008034 vs. Swiss-Prot
Match: RLF4_ARATH (Protein RALF-like 4 OS=Arabidopsis thaliana GN=RALFL4 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 6.9e-16 Identity = 35/47 (74.47%), Postives = 39/47 (82.98%), Query Frame = 1
BLAST of MELO3C008034 vs. Swiss-Prot
Match: RLF19_ARATH (Protein RALF-like 19 OS=Arabidopsis thaliana GN=RALFL19 PE=3 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.4e-15 Identity = 49/113 (43.36%), Postives = 59/113 (52.21%), Query Frame = 1
BLAST of MELO3C008034 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 8.7e-11 Identity = 32/71 (45.07%), Postives = 41/71 (57.75%), Query Frame = 1
BLAST of MELO3C008034 vs. Swiss-Prot
Match: RALF_TOBAC (Rapid alkalinization factor OS=Nicotiana tabacum GN=RALF PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 8.7e-11 Identity = 33/73 (45.21%), Postives = 41/73 (56.16%), Query Frame = 1
BLAST of MELO3C008034 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.9e-10 Identity = 31/71 (43.66%), Postives = 41/71 (57.75%), Query Frame = 1
BLAST of MELO3C008034 vs. TrEMBL
Match: A0A0A0KHU4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G484570 PE=4 SV=1) HSP 1 Score: 210.7 bits (535), Expect = 9.3e-52 Identity = 99/112 (88.39%), Postives = 104/112 (92.86%), Query Frame = 1
BLAST of MELO3C008034 vs. TrEMBL
Match: A0A0A0KCD7_CUCSA (F3H9.8 protein OS=Cucumis sativus GN=Csa_6G199790 PE=4 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 4.0e-39 Identity = 86/117 (73.50%), Postives = 93/117 (79.49%), Query Frame = 1
BLAST of MELO3C008034 vs. TrEMBL
Match: M4EMR1_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.0e-14 Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 1
BLAST of MELO3C008034 vs. TrEMBL
Match: A0A078FS15_BRANA (BnaA07g08550D protein OS=Brassica napus GN=BnaA07g08550D PE=4 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 2.0e-14 Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 1
BLAST of MELO3C008034 vs. TrEMBL
Match: M4EVQ5_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 5.9e-14 Identity = 35/47 (74.47%), Postives = 40/47 (85.11%), Query Frame = 1
BLAST of MELO3C008034 vs. TAIR10
Match: AT1G28270.1 (AT1G28270.1 ralf-like 4) HSP 1 Score: 84.7 bits (208), Expect = 3.9e-17 Identity = 35/47 (74.47%), Postives = 39/47 (82.98%), Query Frame = 1
BLAST of MELO3C008034 vs. TAIR10
Match: AT2G33775.1 (AT2G33775.1 ralf-like 19) HSP 1 Score: 82.4 bits (202), Expect = 1.9e-16 Identity = 49/113 (43.36%), Postives = 59/113 (52.21%), Query Frame = 1
BLAST of MELO3C008034 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 67.8 bits (164), Expect = 4.9e-12 Identity = 32/71 (45.07%), Postives = 41/71 (57.75%), Query Frame = 1
BLAST of MELO3C008034 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 66.6 bits (161), Expect = 1.1e-11 Identity = 31/71 (43.66%), Postives = 41/71 (57.75%), Query Frame = 1
BLAST of MELO3C008034 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 65.1 bits (157), Expect = 3.2e-11 Identity = 30/67 (44.78%), Postives = 40/67 (59.70%), Query Frame = 1
BLAST of MELO3C008034 vs. NCBI nr
Match: gi|659080853|ref|XP_008441015.1| (PREDICTED: protein RALF-like 19 [Cucumis melo]) HSP 1 Score: 239.6 bits (610), Expect = 2.7e-60 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 1
BLAST of MELO3C008034 vs. NCBI nr
Match: gi|449461879|ref|XP_004148669.1| (PREDICTED: protein RALF-like 19 [Cucumis sativus]) HSP 1 Score: 210.7 bits (535), Expect = 1.3e-51 Identity = 99/112 (88.39%), Postives = 104/112 (92.86%), Query Frame = 1
BLAST of MELO3C008034 vs. NCBI nr
Match: gi|449466199|ref|XP_004150814.1| (PREDICTED: protein RALF-like 4 [Cucumis sativus]) HSP 1 Score: 168.7 bits (426), Expect = 5.8e-39 Identity = 86/117 (73.50%), Postives = 93/117 (79.49%), Query Frame = 1
BLAST of MELO3C008034 vs. NCBI nr
Match: gi|674917517|emb|CDY15684.1| (BnaA07g08550D [Brassica napus]) HSP 1 Score: 86.7 bits (213), Expect = 2.9e-14 Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 1
BLAST of MELO3C008034 vs. NCBI nr
Match: gi|922490694|ref|XP_013584908.1| (PREDICTED: protein RALF-like 4 [Brassica oleracea var. oleracea]) HSP 1 Score: 85.1 bits (209), Expect = 8.4e-14 Identity = 35/47 (74.47%), Postives = 40/47 (85.11%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|