MELO3C006979 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAAGATTGTGGAGAGTTGGAAAATCACGAATGGTGAAACAAATTCAATCAACCTCCAACAACAAAGAGCTTAGTAAAATGAAGTCATCCAATATACAATCTACGCAAGATTGGATGGACTTTGTGAAAGAAAAGAAGAGTGCACGGTTCAAGGTAAGTCAATGCAGCCATTTGTTTTAAAAGACACATATAAGTACAATTTATGTTTGATGATTAATCCATTTGTGTTTGATTAGGCTGAAAGTGCAAAGTTCAAATCAATGAAGAAGAGGCAACTTCCACATACATGTAGCTGTAAAGGTTATGCTCGACTGGCGGAAGATTTGGTATTCATTATTCTAAAGTAA ATGGGAAGATTGTGGAGAGTTGGAAAATCACGAATGGTGAAACAAATTCAATCAACCTCCAACAACAAAGAGCTTAGTAAAATGAAGTCATCCAATATACAATCTACGCAAGATTGGATGGACTTTGTGAAAGAAAAGAAGAGTGCACGGTTCAAGGCTGAAAGTGCAAAGTTCAAATCAATGAAGAAGAGGCAACTTCCACATACATGTAGCTGTAAAGGTTATGCTCGACTGGCGGAAGATTTGGTATTCATTATTCTAAAGTAA ATGGGAAGATTGTGGAGAGTTGGAAAATCACGAATGGTGAAACAAATTCAATCAACCTCCAACAACAAAGAGCTTAGTAAAATGAAGTCATCCAATATACAATCTACGCAAGATTGGATGGACTTTGTGAAAGAAAAGAAGAGTGCACGGTTCAAGGCTGAAAGTGCAAAGTTCAAATCAATGAAGAAGAGGCAACTTCCACATACATGTAGCTGTAAAGGTTATGCTCGACTGGCGGAAGATTTGGTATTCATTATTCTAAAGTAA MGRLWRVGKSRMVKQIQSTSNNKELSKMKSSNIQSTQDWMDFVKEKKSARFKAESAKFKSMKKRQLPHTCSCKGYARLAEDLVFIILK*
BLAST of MELO3C006979 vs. TrEMBL
Match: A0A0A0L5I2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G113900 PE=4 SV=1) HSP 1 Score: 134.8 bits (338), Expect = 5.1e-29 Identity = 65/82 (79.27%), Postives = 71/82 (86.59%), Query Frame = 1
BLAST of MELO3C006979 vs. TrEMBL
Match: A0A0A0L5I2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G113900 PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 3.0e-13 Identity = 41/64 (64.06%), Postives = 47/64 (73.44%), Query Frame = 1
HSP 2 Score: 35.0 bits (79), Expect = 5.5e+01 Identity = 21/48 (43.75%), Postives = 26/48 (54.17%), Query Frame = 1
HSP 3 Score: 94.7 bits (234), Expect = 5.9e-17 Identity = 42/82 (51.22%), Postives = 59/82 (71.95%), Query Frame = 1
BLAST of MELO3C006979 vs. TrEMBL
Match: Q9C6V0_ARATH (En/Spm-like transposon protein, putative OS=Arabidopsis thaliana GN=F27M3_21 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 3.7e-11 Identity = 40/82 (48.78%), Postives = 50/82 (60.98%), Query Frame = 1
BLAST of MELO3C006979 vs. TrEMBL
Match: Q9LH86_ARATH (En/Spm transposon protein-like OS=Arabidopsis thaliana PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.5e-09 Identity = 31/82 (37.80%), Postives = 50/82 (60.98%), Query Frame = 1
BLAST of MELO3C006979 vs. TrEMBL
Match: A0A0D2ZQ01_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.0e-08 Identity = 30/82 (36.59%), Postives = 47/82 (57.32%), Query Frame = 1
BLAST of MELO3C006979 vs. NCBI nr
Match: gi|778676496|ref|XP_011650597.1| (PREDICTED: uncharacterized protein LOC101217008 isoform X7 [Cucumis sativus]) HSP 1 Score: 134.8 bits (338), Expect = 7.4e-29 Identity = 65/82 (79.27%), Postives = 71/82 (86.59%), Query Frame = 1
BLAST of MELO3C006979 vs. NCBI nr
Match: gi|778676496|ref|XP_011650597.1| (PREDICTED: uncharacterized protein LOC101217008 isoform X7 [Cucumis sativus]) HSP 1 Score: 132.1 bits (331), Expect = 4.8e-28 Identity = 63/83 (75.90%), Postives = 73/83 (87.95%), Query Frame = 1
HSP 2 Score: 111.7 bits (278), Expect = 6.7e-22 Identity = 57/82 (69.51%), Postives = 65/82 (79.27%), Query Frame = 1
HSP 3 Score: 134.8 bits (338), Expect = 7.4e-29 Identity = 65/82 (79.27%), Postives = 71/82 (86.59%), Query Frame = 1
BLAST of MELO3C006979 vs. NCBI nr
Match: gi|700201166|gb|KGN56299.1| (hypothetical protein Csa_3G113900 [Cucumis sativus]) HSP 1 Score: 82.4 bits (202), Expect = 4.3e-13 Identity = 41/64 (64.06%), Postives = 47/64 (73.44%), Query Frame = 1
HSP 2 Score: 35.0 bits (79), Expect = 7.9e+01 Identity = 21/48 (43.75%), Postives = 26/48 (54.17%), Query Frame = 1
HSP 3 Score: 134.8 bits (338), Expect = 7.4e-29 Identity = 65/82 (79.27%), Postives = 71/82 (86.59%), Query Frame = 1
BLAST of MELO3C006979 vs. NCBI nr
Match: gi|778676482|ref|XP_011650591.1| (PREDICTED: uncharacterized protein LOC101217008 isoform X2 [Cucumis sativus]) HSP 1 Score: 131.0 bits (328), Expect = 1.1e-27 Identity = 63/82 (76.83%), Postives = 72/82 (87.80%), Query Frame = 1
HSP 2 Score: 111.7 bits (278), Expect = 6.7e-22 Identity = 57/82 (69.51%), Postives = 65/82 (79.27%), Query Frame = 1
HSP 3 Score: 134.8 bits (338), Expect = 7.4e-29 Identity = 65/82 (79.27%), Postives = 71/82 (86.59%), Query Frame = 1
BLAST of MELO3C006979 vs. NCBI nr
Match: gi|778676487|ref|XP_011650593.1| (PREDICTED: uncharacterized protein LOC101217008 isoform X4 [Cucumis sativus]) HSP 1 Score: 131.0 bits (328), Expect = 1.1e-27 Identity = 63/82 (76.83%), Postives = 72/82 (87.80%), Query Frame = 1
HSP 2 Score: 111.7 bits (278), Expect = 6.7e-22 Identity = 57/82 (69.51%), Postives = 65/82 (79.27%), Query Frame = 1
HSP 3 Score: 134.8 bits (338), Expect = 7.4e-29 Identity = 65/82 (79.27%), Postives = 71/82 (86.59%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |