MELO3C006905 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATTTGGAAGCAAAGGCTGATTTGGCGAAATTGAGACTGAAAGAGATGGAGAAAGTAAAAAACAAAGAGGCAGAGACTCATAAGGCAGTTGAATCAAAGAAAGCATCCATTGAAGCTAAAAGAGAGCTTAGAAAACTCAAGGTTGAAGAGAGAGCTAAAATGCATAGATGTACCAATACTGTTCCTAAAAAGTGTTTTGGCATTTGCAACGACTGA ATGAATTTGGAAGCAAAGGCTGATTTGGCGAAATTGAGACTGAAAGAGATGGAGAAAGTAAAAAACAAAGAGGCAGAGACTCATAAGGCAGTTGAATCAAAGAAAGCATCCATTGAAGCTAAAAGAGAGCTTAGAAAACTCAAGGTTGAAGAGAGAGCTAAAATGCATAGATGTACCAATACTGTTCCTAAAAAGTGTTTTGGCATTTGCAACGACTGA ATGAATTTGGAAGCAAAGGCTGATTTGGCGAAATTGAGACTGAAAGAGATGGAGAAAGTAAAAAACAAAGAGGCAGAGACTCATAAGGCAGTTGAATCAAAGAAAGCATCCATTGAAGCTAAAAGAGAGCTTAGAAAACTCAAGGTTGAAGAGAGAGCTAAAATGCATAGATGTACCAATACTGTTCCTAAAAAGTGTTTTGGCATTTGCAACGACTGA MNLEAKADLAKLRLKEMEKVKNKEAETHKAVESKKASIEAKRELRKLKVEERAKMHRCTNTVPKKCFGICND*
BLAST of MELO3C006905 vs. Swiss-Prot
Match: REMO_SOLTU (Remorin OS=Solanum tuberosum PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.3e-07 Identity = 35/73 (47.95%), Postives = 39/73 (53.42%), Query Frame = 1
BLAST of MELO3C006905 vs. TrEMBL
Match: A0A0A0L6I9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G182090 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.2e-25 Identity = 59/66 (89.39%), Postives = 63/66 (95.45%), Query Frame = 1
BLAST of MELO3C006905 vs. TrEMBL
Match: B9I495_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0012s13220g PE=4 SV=2) HSP 1 Score: 73.9 bits (180), Expect = 8.8e-11 Identity = 32/70 (45.71%), Postives = 51/70 (72.86%), Query Frame = 1
BLAST of MELO3C006905 vs. TrEMBL
Match: M5XGF5_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa019961mg PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.8e-09 Identity = 33/62 (53.23%), Postives = 44/62 (70.97%), Query Frame = 1
BLAST of MELO3C006905 vs. TrEMBL
Match: A0A061G0V6_THECC (Remorin family protein OS=Theobroma cacao GN=TCM_015160 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.1e-08 Identity = 29/57 (50.88%), Postives = 44/57 (77.19%), Query Frame = 1
BLAST of MELO3C006905 vs. TrEMBL
Match: A0A061G0V6_THECC (Remorin family protein OS=Theobroma cacao GN=TCM_015160 PE=4 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.7e-04 Identity = 29/60 (48.33%), Postives = 34/60 (56.67%), Query Frame = 1
HSP 2 Score: 62.8 bits (151), Expect = 2.0e-07 Identity = 33/58 (56.90%), Postives = 37/58 (63.79%), Query Frame = 1
BLAST of MELO3C006905 vs. TAIR10
Match: AT5G23750.1 (AT5G23750.1 Remorin family protein) HSP 1 Score: 57.8 bits (138), Expect = 3.3e-09 Identity = 30/60 (50.00%), Postives = 36/60 (60.00%), Query Frame = 1
BLAST of MELO3C006905 vs. TAIR10
Match: AT3G48940.1 (AT3G48940.1 Remorin family protein) HSP 1 Score: 51.6 bits (122), Expect = 2.4e-07 Identity = 28/60 (46.67%), Postives = 32/60 (53.33%), Query Frame = 1
BLAST of MELO3C006905 vs. TAIR10
Match: AT3G61260.1 (AT3G61260.1 Remorin family protein) HSP 1 Score: 49.3 bits (116), Expect = 1.2e-06 Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = 1
BLAST of MELO3C006905 vs. TAIR10
Match: AT2G45820.1 (AT2G45820.1 Remorin family protein) HSP 1 Score: 48.9 bits (115), Expect = 1.5e-06 Identity = 26/60 (43.33%), Postives = 31/60 (51.67%), Query Frame = 1
BLAST of MELO3C006905 vs. NCBI nr
Match: gi|449446163|ref|XP_004140841.1| (PREDICTED: remorin-like [Cucumis sativus]) HSP 1 Score: 122.5 bits (306), Expect = 3.1e-25 Identity = 59/66 (89.39%), Postives = 63/66 (95.45%), Query Frame = 1
BLAST of MELO3C006905 vs. NCBI nr
Match: gi|743857151|ref|XP_011030105.1| (PREDICTED: uncharacterized protein LOC105129652 isoform X1 [Populus euphratica]) HSP 1 Score: 74.7 bits (182), Expect = 7.4e-11 Identity = 32/70 (45.71%), Postives = 51/70 (72.86%), Query Frame = 1
BLAST of MELO3C006905 vs. NCBI nr
Match: gi|566198277|ref|XP_002318223.2| (hypothetical protein POPTR_0012s13220g [Populus trichocarpa]) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-10 Identity = 32/70 (45.71%), Postives = 51/70 (72.86%), Query Frame = 1
BLAST of MELO3C006905 vs. NCBI nr
Match: gi|743857159|ref|XP_011030107.1| (PREDICTED: transmembrane ascorbate ferrireductase 1-like isoform X3 [Populus euphratica]) HSP 1 Score: 73.9 bits (180), Expect = 1.3e-10 Identity = 32/67 (47.76%), Postives = 49/67 (73.13%), Query Frame = 1
BLAST of MELO3C006905 vs. NCBI nr
Match: gi|645257094|ref|XP_008234254.1| (PREDICTED: remorin-like [Prunus mume]) HSP 1 Score: 68.6 bits (166), Expect = 5.3e-09 Identity = 35/70 (50.00%), Postives = 48/70 (68.57%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |