MELO3C006391 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGATGCTGCAGCAAATCAAGAAGCAGGACTCGACCTCCACAACTACACGAAAGATGGAACCGTCGATTGGAAGGGCAACACCGTTCTCCGCTCCAAAACCGGCCGGTGGAAAGCCTGTTCTTTCATCCTCGGTATAACCATTTTTTTTTTTTTTTCAATTATCATTATTATTATTATTTGCATATGACCACCGTTGACCCGATCGTATTTAAGGCTTTTTTTTTTCCTTTTTTCTTTCAGGGTACGAACTAATCGAGAGAATGATGTTCCATGGGATTTCGGCCAATCTCATTATATATTTGACTACTAAACTCAATCAAGACACTCTCACTGCTTCTAACAATGTCACCAATTGGAGCGGAACCGTTTGGATTATGCCCATCATCGGGGCTTATGTGGCCGATGCTCATCTCGGTCGCTATCGCACCTTCTTCATCTCCTCTCTCGTTTGTTTTATGGTATGA ATGGCGGATGCTGCAGCAAATCAAGAAGCAGGACTCGACCTCCACAACTACACGAAAGATGGAACCGTCGATTGGAAGGGCAACACCGTTCTCCGCTCCAAAACCGGCCGGTGGAAAGCCTGTTCTTTCATCCTCGGGTACGAACTAATCGAGAGAATGATGTTCCATGGGATTTCGGCCAATCTCATTATATATTTGACTACTAAACTCAATCAAGACACTCTCACTGCTTCTAACAATGTCACCAATTGGAGCGGAACCGTTTGGATTATGCCCATCATCGGGGCTTATGTGGCCGATGCTCATCTCGGTCGCTATCGCACCTTCTTCATCTCCTCTCTCGTTTGTTTTATGGTATGA ATGGCGGATGCTGCAGCAAATCAAGAAGCAGGACTCGACCTCCACAACTACACGAAAGATGGAACCGTCGATTGGAAGGGCAACACCGTTCTCCGCTCCAAAACCGGCCGGTGGAAAGCCTGTTCTTTCATCCTCGGGTACGAACTAATCGAGAGAATGATGTTCCATGGGATTTCGGCCAATCTCATTATATATTTGACTACTAAACTCAATCAAGACACTCTCACTGCTTCTAACAATGTCACCAATTGGAGCGGAACCGTTTGGATTATGCCCATCATCGGGGCTTATGTGGCCGATGCTCATCTCGGTCGCTATCGCACCTTCTTCATCTCCTCTCTCGTTTGTTTTATGGTATGA MADAAANQEAGLDLHNYTKDGTVDWKGNTVLRSKTGRWKACSFILGYELIERMMFHGISANLIIYLTTKLNQDTLTASNNVTNWSGTVWIMPIIGAYVADAHLGRYRTFFISSLVCFMV*
BLAST of MELO3C006391 vs. Swiss-Prot
Match: PTR4_ARATH (Protein NRT1/ PTR FAMILY 5.3 OS=Arabidopsis thaliana GN=NPF5.3 PE=2 SV=1) HSP 1 Score: 152.1 bits (383), Expect = 3.8e-36 Identity = 68/100 (68.00%), Postives = 83/100 (83.00%), Query Frame = 1
BLAST of MELO3C006391 vs. Swiss-Prot
Match: PTR3_ARATH (Protein NRT1/ PTR FAMILY 5.2 OS=Arabidopsis thaliana GN=NPF5.2 PE=2 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.9e-33 Identity = 66/102 (64.71%), Postives = 79/102 (77.45%), Query Frame = 1
BLAST of MELO3C006391 vs. Swiss-Prot
Match: PTR30_ARATH (Protein NRT1/ PTR FAMILY 5.1 OS=Arabidopsis thaliana GN=NPF5.1 PE=2 SV=2) HSP 1 Score: 139.4 bits (350), Expect = 2.5e-32 Identity = 61/99 (61.62%), Postives = 79/99 (79.80%), Query Frame = 1
BLAST of MELO3C006391 vs. Swiss-Prot
Match: PTR1_ARATH (Protein NRT1/ PTR FAMILY 8.1 OS=Arabidopsis thaliana GN=NPF8.1 PE=1 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 2.7e-26 Identity = 54/92 (58.70%), Postives = 67/92 (72.83%), Query Frame = 1
BLAST of MELO3C006391 vs. Swiss-Prot
Match: PTR2_ARATH (Protein NRT1/ PTR FAMILY 8.3 OS=Arabidopsis thaliana GN=NPF8.3 PE=1 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 7.9e-26 Identity = 58/113 (51.33%), Postives = 76/113 (67.26%), Query Frame = 1
BLAST of MELO3C006391 vs. TrEMBL
Match: A0A0A0L4Z4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G134760 PE=4 SV=1) HSP 1 Score: 224.6 bits (571), Expect = 6.6e-56 Identity = 109/119 (91.60%), Postives = 115/119 (96.64%), Query Frame = 1
BLAST of MELO3C006391 vs. TrEMBL
Match: A0A0A0L706_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G134770 PE=4 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 7.9e-41 Identity = 82/113 (72.57%), Postives = 98/113 (86.73%), Query Frame = 1
BLAST of MELO3C006391 vs. TrEMBL
Match: I1N9T4_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_19G167000 PE=4 SV=2) HSP 1 Score: 157.5 bits (397), Expect = 1.0e-35 Identity = 69/100 (69.00%), Postives = 87/100 (87.00%), Query Frame = 1
BLAST of MELO3C006391 vs. TrEMBL
Match: U5CZY9_AMBTC (Uncharacterized protein OS=Amborella trichopoda GN=AMTR_s00067p00183540 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.3e-35 Identity = 73/119 (61.34%), Postives = 98/119 (82.35%), Query Frame = 1
BLAST of MELO3C006391 vs. TrEMBL
Match: A0A078IHA6_BRANA (BnaA02g24250D protein OS=Brassica napus GN=BnaA02g24250D PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.7e-35 Identity = 73/113 (64.60%), Postives = 93/113 (82.30%), Query Frame = 1
BLAST of MELO3C006391 vs. TAIR10
Match: AT5G46040.1 (AT5G46040.1 Major facilitator superfamily protein) HSP 1 Score: 152.1 bits (383), Expect = 2.1e-37 Identity = 68/100 (68.00%), Postives = 83/100 (83.00%), Query Frame = 1
BLAST of MELO3C006391 vs. TAIR10
Match: AT5G46050.1 (AT5G46050.1 peptide transporter 3) HSP 1 Score: 142.1 bits (357), Expect = 2.2e-34 Identity = 66/102 (64.71%), Postives = 79/102 (77.45%), Query Frame = 1
BLAST of MELO3C006391 vs. TAIR10
Match: AT2G40460.1 (AT2G40460.1 Major facilitator superfamily protein) HSP 1 Score: 139.4 bits (350), Expect = 1.4e-33 Identity = 61/99 (61.62%), Postives = 79/99 (79.80%), Query Frame = 1
BLAST of MELO3C006391 vs. TAIR10
Match: AT3G54140.1 (AT3G54140.1 peptide transporter 1) HSP 1 Score: 119.4 bits (298), Expect = 1.5e-27 Identity = 54/92 (58.70%), Postives = 67/92 (72.83%), Query Frame = 1
BLAST of MELO3C006391 vs. TAIR10
Match: AT2G02040.1 (AT2G02040.1 peptide transporter 2) HSP 1 Score: 117.9 bits (294), Expect = 4.4e-27 Identity = 58/113 (51.33%), Postives = 76/113 (67.26%), Query Frame = 1
BLAST of MELO3C006391 vs. NCBI nr
Match: gi|659076059|ref|XP_008438479.1| (PREDICTED: protein NRT1/ PTR FAMILY 5.3-like [Cucumis melo]) HSP 1 Score: 228.4 bits (581), Expect = 6.6e-57 Identity = 110/119 (92.44%), Postives = 114/119 (95.80%), Query Frame = 1
BLAST of MELO3C006391 vs. NCBI nr
Match: gi|700201695|gb|KGN56828.1| (hypothetical protein Csa_3G134760 [Cucumis sativus]) HSP 1 Score: 224.6 bits (571), Expect = 9.5e-56 Identity = 109/119 (91.60%), Postives = 115/119 (96.64%), Query Frame = 1
BLAST of MELO3C006391 vs. NCBI nr
Match: gi|659076057|ref|XP_008438477.1| (PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Cucumis melo]) HSP 1 Score: 177.2 bits (448), Expect = 1.7e-41 Identity = 85/116 (73.28%), Postives = 99/116 (85.34%), Query Frame = 1
BLAST of MELO3C006391 vs. NCBI nr
Match: gi|449433235|ref|XP_004134403.1| (PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Cucumis sativus]) HSP 1 Score: 174.5 bits (441), Expect = 1.1e-40 Identity = 82/113 (72.57%), Postives = 98/113 (86.73%), Query Frame = 1
BLAST of MELO3C006391 vs. NCBI nr
Match: gi|778678110|ref|XP_011650916.1| (PREDICTED: protein NRT1/ PTR FAMILY 5.2-like [Cucumis sativus]) HSP 1 Score: 164.9 bits (416), Expect = 9.0e-38 Identity = 77/111 (69.37%), Postives = 93/111 (83.78%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |