MELO3C002323 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTTACGCCTTTGTACGTGTTCGCGATTTCAAAAGAGCTTTCTTCTATCACAAGAAGATGGTAAAAAGTGGACAAGTGCCTGATGTAAAGTCATACCAGAAACTTAAATCGATCTTGGATGTAAAACTTGCTACAAAGAACAGGAAAGACAAGAGTGCCATTCTTGGTATAATAAACAGCAAAATGGGTATGGTGAAAGCAAAGCAGAAAGGCAAGAAAGATGAGTTTTGGAAGACCAAGAGAAGGCATGTAAGAACTTAG ATGATTTACGCCTTTGTACGTGTTCGCGATTTCAAAAGAGCTTTCTTCTATCACAAGAAGATGGTAAAAAGTGGACAAGTGCCTGATGTAAAGTCATACCAGAAACTTAAATCGATCTTGGATGTAAAACTTGCTACAAAGAACAGGAAAGACAAGAGTGCCATTCTTGGTATAATAAACAGCAAAATGGGTATGGTGAAAGCAAAGCAGAAAGGCAAGAAAGATGAGTTTTGGAAGACCAAGAGAAGGCATGTAAGAACTTAG ATGATTTACGCCTTTGTACGTGTTCGCGATTTCAAAAGAGCTTTCTTCTATCACAAGAAGATGGTAAAAAGTGGACAAGTGCCTGATGTAAAGTCATACCAGAAACTTAAATCGATCTTGGATGTAAAACTTGCTACAAAGAACAGGAAAGACAAGAGTGCCATTCTTGGTATAATAAACAGCAAAATGGGTATGGTGAAAGCAAAGCAGAAAGGCAAGAAAGATGAGTTTTGGAAGACCAAGAGAAGGCATGTAAGAACTTAG MIYAFVRVRDFKRAFFYHKKMVKSGQVPDVKSYQKLKSILDVKLATKNRKDKSAILGIINSKMGMVKAKQKGKKDEFWKTKRRHVRT*
BLAST of MELO3C002323 vs. Swiss-Prot
Match: PP426_ARATH (Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana GN=EMB1006 PE=2 SV=1) HSP 1 Score: 135.6 bits (340), Expect = 2.7e-31 Identity = 66/81 (81.48%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of MELO3C002323 vs. TrEMBL
Match: A0A0A0LWH7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G050000 PE=4 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 2.2e-40 Identity = 85/87 (97.70%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of MELO3C002323 vs. TrEMBL
Match: V4TNK4_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10019054mg PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 3.9e-37 Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = 1
BLAST of MELO3C002323 vs. TrEMBL
Match: A0A067FPS3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g044251mg PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 3.9e-37 Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = 1
BLAST of MELO3C002323 vs. TrEMBL
Match: A0A061G5M6_THECC (Pentatricopeptide repeat superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_014542 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.2e-33 Identity = 72/87 (82.76%), Postives = 81/87 (93.10%), Query Frame = 1
BLAST of MELO3C002323 vs. TrEMBL
Match: A0A0D2N683_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G062100 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 9.9e-33 Identity = 71/87 (81.61%), Postives = 82/87 (94.25%), Query Frame = 1
BLAST of MELO3C002323 vs. TAIR10
Match: AT5G50280.1 (AT5G50280.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 135.6 bits (340), Expect = 1.5e-32 Identity = 66/81 (81.48%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of MELO3C002323 vs. NCBI nr
Match: gi|659067377|ref|XP_008439140.1| (PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Cucumis melo]) HSP 1 Score: 175.6 bits (444), Expect = 3.7e-41 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of MELO3C002323 vs. NCBI nr
Match: gi|778657971|ref|XP_004152584.2| (PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Cucumis sativus]) HSP 1 Score: 172.6 bits (436), Expect = 3.2e-40 Identity = 85/87 (97.70%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of MELO3C002323 vs. NCBI nr
Match: gi|641850527|gb|KDO69399.1| (hypothetical protein CISIN_1g044251mg [Citrus sinensis]) HSP 1 Score: 161.8 bits (408), Expect = 5.6e-37 Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = 1
BLAST of MELO3C002323 vs. NCBI nr
Match: gi|567895014|ref|XP_006439995.1| (hypothetical protein CICLE_v10019054mg [Citrus clementina]) HSP 1 Score: 161.8 bits (408), Expect = 5.6e-37 Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = 1
BLAST of MELO3C002323 vs. NCBI nr
Match: gi|568846190|ref|XP_006476940.1| (PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Citrus sinensis]) HSP 1 Score: 161.8 bits (408), Expect = 5.6e-37 Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|