Lsi11G006510 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAATGACTTGATAGTATGTGAAAATGCATATAAGATAGTGAAGGAAGCATTTGAGGAAGGGATTAAGTTATTCTCACAAGGAGATTACAAAGGAATGTTGAATTCTGAGAGGATTACACCAAGAGCACAAGCAAGTTGTGATGAGATTTTCAGTACACCACCAGCTAAACAAAGCCCATTGTTGGAAAGGAATAGGGAGATGAGGATTTTGATTGCTATGGCTATAGTTTCTGGTTCAAGTATTCCATGA ATGAAGAATGACTTGATAGTATGTGAAAATGCATATAAGATAGTGAAGGAAGCATTTGAGGAAGGGATTAAGTTATTCTCACAAGGAGATTACAAAGGAATGTTGAATTCTGAGAGGATTACACCAAGAGCACAAGCAAGTTGTGATGAGATTTTCAGTACACCACCAGCTAAACAAAGCCCATTGTTGGAAAGGAATAGGGAGATGAGGATTTTGATTGCTATGGCTATAGTTTCTGGTTCAAGTATTCCATGA ATGAAGAATGACTTGATAGTATGTGAAAATGCATATAAGATAGTGAAGGAAGCATTTGAGGAAGGGATTAAGTTATTCTCACAAGGAGATTACAAAGGAATGTTGAATTCTGAGAGGATTACACCAAGAGCACAAGCAAGTTGTGATGAGATTTTCAGTACACCACCAGCTAAACAAAGCCCATTGTTGGAAAGGAATAGGGAGATGAGGATTTTGATTGCTATGGCTATAGTTTCTGGTTCAAGTATTCCATGA MKNDLIVCENAYKIVKEAFEEGIKLFSQGDYKGMLNSERITPRAQASCDEIFSTPPAKQSPLLERNREMRILIAMAIVSGSSIP
BLAST of Lsi11G006510 vs. TrEMBL
Match: A0A0A0LGJ6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G034680 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.6e-19 Identity = 56/80 (70.00%), Postives = 61/80 (76.25%), Query Frame = 1
BLAST of Lsi11G006510 vs. TrEMBL
Match: A0A0A0LM47_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G034690 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 3.5e-19 Identity = 55/83 (66.27%), Postives = 61/83 (73.49%), Query Frame = 1
BLAST of Lsi11G006510 vs. TrEMBL
Match: A0A0D2ST66_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G298200 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.9e-17 Identity = 46/82 (56.10%), Postives = 58/82 (70.73%), Query Frame = 1
BLAST of Lsi11G006510 vs. TrEMBL
Match: B9N451_POPTR (Invertase/pectin methylesterase inhibitor family protein OS=Populus trichocarpa GN=POPTR_0005s00890g PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 5.6e-17 Identity = 44/83 (53.01%), Postives = 58/83 (69.88%), Query Frame = 1
BLAST of Lsi11G006510 vs. TrEMBL
Match: B9RED7_RICCO (Enzyme inhibitor, putative OS=Ricinus communis GN=RCOM_1620790 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.1e-16 Identity = 43/81 (53.09%), Postives = 59/81 (72.84%), Query Frame = 1
BLAST of Lsi11G006510 vs. TAIR10
Match: AT1G09360.1 (AT1G09360.1 Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 49.3 bits (116), Expect = 1.4e-06 Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 1
BLAST of Lsi11G006510 vs. NCBI nr
Match: gi|659071554|ref|XP_008460590.1| (PREDICTED: uncharacterized protein LOC103499372 [Cucumis melo]) HSP 1 Score: 128.6 bits (322), Expect = 5.0e-27 Identity = 63/84 (75.00%), Postives = 76/84 (90.48%), Query Frame = 1
BLAST of Lsi11G006510 vs. NCBI nr
Match: gi|659071542|ref|XP_008460509.1| (PREDICTED: uncharacterized protein LOC103499305 [Cucumis melo]) HSP 1 Score: 125.6 bits (314), Expect = 4.2e-26 Identity = 65/84 (77.38%), Postives = 72/84 (85.71%), Query Frame = 1
BLAST of Lsi11G006510 vs. NCBI nr
Match: gi|659071552|ref|XP_008460578.1| (PREDICTED: uncharacterized protein LOC103499366 [Cucumis melo]) HSP 1 Score: 123.2 bits (308), Expect = 2.1e-25 Identity = 63/84 (75.00%), Postives = 71/84 (84.52%), Query Frame = 1
BLAST of Lsi11G006510 vs. NCBI nr
Match: gi|659071548|ref|XP_008460537.1| (PREDICTED: uncharacterized protein LOC103499331 [Cucumis melo]) HSP 1 Score: 114.4 bits (285), Expect = 9.7e-23 Identity = 58/83 (69.88%), Postives = 69/83 (83.13%), Query Frame = 1
BLAST of Lsi11G006510 vs. NCBI nr
Match: gi|659071550|ref|XP_008460566.1| (PREDICTED: uncharacterized protein LOC103499358 [Cucumis melo]) HSP 1 Score: 111.3 bits (277), Expect = 8.2e-22 Identity = 55/76 (72.37%), Postives = 65/76 (85.53%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|