Lsi10G004340 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTTCGTTTCGCGAAAATTGTTAATGTTGTGCATAATCTAGGACTTTCTTATCTAGCAACAAACCAAGAATCACCAATTGTCCGCAAAGGTTATTGTGCCGTTTATGTTGGAGAGAGCCAAAGGAAGCGTTTTGTGATTCCAATAGCTTACTTGAATCGGCCATTTTTCAAAGATTTGCTCAGTCAAGTTGAAGAGGAATTTGGTTACAATCACCCCATGGGAGGTCTCACCATTCCCTGCAGTGATGATACATTCATCGATCTCATCTCTCAGTTGCATTAG ATGGGTTTTCGTTTCGCGAAAATTGTTAATGTTGTGCATAATCTAGGACTTTCTTATCTAGCAACAAACCAAGAATCACCAATTGTCCGCAAAGGTTATTGTGCCGTTTATGTTGGAGAGAGCCAAAGGAAGCGTTTTGTGATTCCAATAGCTTACTTGAATCGGCCATTTTTCAAAGATTTGCTCAGTCAAGTTGAAGAGGAATTTGGTTACAATCACCCCATGGGAGGTCTCACCATTCCCTGCAGTGATGATACATTCATCGATCTCATCTCTCAGTTGCATTAG ATGGGTTTTCGTTTCGCGAAAATTGTTAATGTTGTGCATAATCTAGGACTTTCTTATCTAGCAACAAACCAAGAATCACCAATTGTCCGCAAAGGTTATTGTGCCGTTTATGTTGGAGAGAGCCAAAGGAAGCGTTTTGTGATTCCAATAGCTTACTTGAATCGGCCATTTTTCAAAGATTTGCTCAGTCAAGTTGAAGAGGAATTTGGTTACAATCACCCCATGGGAGGTCTCACCATTCCCTGCAGTGATGATACATTCATCGATCTCATCTCTCAGTTGCATTAG MGFRFAKIVNVVHNLGLSYLATNQESPIVRKGYCAVYVGESQRKRFVIPIAYLNRPFFKDLLSQVEEEFGYNHPMGGLTIPCSDDTFIDLISQLH
BLAST of Lsi10G004340 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 4.2e-22 Identity = 43/65 (66.15%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of Lsi10G004340 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 3.5e-21 Identity = 42/64 (65.62%), Postives = 58/64 (90.62%), Query Frame = 1
BLAST of Lsi10G004340 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 3.5e-21 Identity = 43/80 (53.75%), Postives = 63/80 (78.75%), Query Frame = 1
BLAST of Lsi10G004340 vs. Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 4.6e-21 Identity = 52/95 (54.74%), Postives = 63/95 (66.32%), Query Frame = 1
BLAST of Lsi10G004340 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.9e-21 Identity = 42/63 (66.67%), Postives = 57/63 (90.48%), Query Frame = 1
BLAST of Lsi10G004340 vs. TrEMBL
Match: A0A0A0LM55_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258630 PE=4 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 1.6e-41 Identity = 83/95 (87.37%), Postives = 85/95 (89.47%), Query Frame = 1
BLAST of Lsi10G004340 vs. TrEMBL
Match: A0A0A0LIY4_CUCSA (SAUR family protein OS=Cucumis sativus GN=Csa_2G258610 PE=4 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 2.3e-35 Identity = 71/95 (74.74%), Postives = 83/95 (87.37%), Query Frame = 1
BLAST of Lsi10G004340 vs. TrEMBL
Match: M5VKD4_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa019366mg PE=4 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.3e-26 Identity = 61/96 (63.54%), Postives = 75/96 (78.12%), Query Frame = 1
BLAST of Lsi10G004340 vs. TrEMBL
Match: M5W086_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013844mg PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 9.7e-26 Identity = 59/98 (60.20%), Postives = 74/98 (75.51%), Query Frame = 1
BLAST of Lsi10G004340 vs. TrEMBL
Match: M5W1D5_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa026172mg PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 2.8e-25 Identity = 62/94 (65.96%), Postives = 72/94 (76.60%), Query Frame = 1
BLAST of Lsi10G004340 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.1 bits (261), Expect = 2.4e-23 Identity = 43/65 (66.15%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of Lsi10G004340 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 103.2 bits (256), Expect = 8.9e-23 Identity = 44/75 (58.67%), Postives = 60/75 (80.00%), Query Frame = 1
BLAST of Lsi10G004340 vs. TAIR10
Match: AT4G38825.1 (AT4G38825.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.8 bits (255), Expect = 1.2e-22 Identity = 43/65 (66.15%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of Lsi10G004340 vs. TAIR10
Match: AT3G03850.1 (AT3G03850.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.4 bits (254), Expect = 1.5e-22 Identity = 49/81 (60.49%), Postives = 63/81 (77.78%), Query Frame = 1
BLAST of Lsi10G004340 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.1 bits (253), Expect = 2.0e-22 Identity = 42/64 (65.62%), Postives = 58/64 (90.62%), Query Frame = 1
BLAST of Lsi10G004340 vs. NCBI nr
Match: gi|700206748|gb|KGN61867.1| (hypothetical protein Csa_2G258630 [Cucumis sativus]) HSP 1 Score: 176.4 bits (446), Expect = 2.4e-41 Identity = 83/95 (87.37%), Postives = 85/95 (89.47%), Query Frame = 1
BLAST of Lsi10G004340 vs. NCBI nr
Match: gi|659116172|ref|XP_008457943.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 157.9 bits (398), Expect = 8.7e-36 Identity = 73/95 (76.84%), Postives = 82/95 (86.32%), Query Frame = 1
BLAST of Lsi10G004340 vs. NCBI nr
Match: gi|700206746|gb|KGN61865.1| (SAUR family protein [Cucumis sativus]) HSP 1 Score: 156.0 bits (393), Expect = 3.3e-35 Identity = 71/95 (74.74%), Postives = 83/95 (87.37%), Query Frame = 1
BLAST of Lsi10G004340 vs. NCBI nr
Match: gi|659116174|ref|XP_008457944.1| (PREDICTED: auxin-induced protein 6B-like [Cucumis melo]) HSP 1 Score: 145.6 bits (366), Expect = 4.5e-32 Identity = 68/81 (83.95%), Postives = 72/81 (88.89%), Query Frame = 1
BLAST of Lsi10G004340 vs. NCBI nr
Match: gi|645263019|ref|XP_008237035.1| (PREDICTED: auxin-induced protein 15A-like [Prunus mume]) HSP 1 Score: 125.9 bits (315), Expect = 3.7e-26 Identity = 60/98 (61.22%), Postives = 76/98 (77.55%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |