Lsi09G007310 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGGAAGGGGCGAAGCACGTGTCAGTTCTTCGTGTGGTGATTAGAGAAGATTTCTCTCGCACACTTGCAGAGCGGCTTGTGCTTGATATCGTGAAGGTTTTGGCAGAGTTAGATACTCTTCCACCAAAGAATAGCGGGAAAATGGGGAGCTTAGAAAATGGTAAAAAGGAAAGAAATGGGAAGAAGACAGCAGAGGAAACAGGGAGGGAAATAGCGAGTTATTGGAGGAATATAACGAAGGCTAGGAAAATCAAGCTTGCTGCTAATCTGGCTAGTCCTTCGGTTACAGTAGTTGCCAAATAA ATGCCGGAAGGGGCGAAGCACGTGTCAGTTCTTCGTGTGGTGATTAGAGAAGATTTCTCTCGCACACTTGCAGAGCGGCTTGTGCTTGATATCGTGAAGGTTTTGGCAGAGTTAGATACTCTTCCACCAAAGAATAGCGGGAAAATGGGGAGCTTAGAAAATGGTAAAAAGGAAAGAAATGGGAAGAAGACAGCAGAGGAAACAGGGAGGGAAATAGCGAGTTATTGGAGGAATATAACGAAGGCTAGGAAAATCAAGCTTGCTGCTAATCTGGCTAGTCCTTCGGTTACAGTAGTTGCCAAATAA ATGCCGGAAGGGGCGAAGCACGTGTCAGTTCTTCGTGTGGTGATTAGAGAAGATTTCTCTCGCACACTTGCAGAGCGGCTTGTGCTTGATATCGTGAAGGTTTTGGCAGAGTTAGATACTCTTCCACCAAAGAATAGCGGGAAAATGGGGAGCTTAGAAAATGGTAAAAAGGAAAGAAATGGGAAGAAGACAGCAGAGGAAACAGGGAGGGAAATAGCGAGTTATTGGAGGAATATAACGAAGGCTAGGAAAATCAAGCTTGCTGCTAATCTGGCTAGTCCTTCGGTTACAGTAGTTGCCAAATAA MPEGAKHVSVLRVVIREDFSRTLAERLVLDIVKVLAELDTLPPKNSGKMGSLENGKKERNGKKTAEETGREIASYWRNITKARKIKLAANLASPSVTVVAK
BLAST of Lsi09G007310 vs. Swiss-Prot
Match: DCE4_ARATH (Glutamate decarboxylase 4 OS=Arabidopsis thaliana GN=GAD4 PE=1 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.3e-16 Identity = 52/85 (61.18%), Postives = 61/85 (71.76%), Query Frame = 1
BLAST of Lsi09G007310 vs. Swiss-Prot
Match: DCE3_ARATH (Glutamate decarboxylase 3 OS=Arabidopsis thaliana GN=GAD3 PE=2 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.1e-15 Identity = 49/86 (56.98%), Postives = 56/86 (65.12%), Query Frame = 1
BLAST of Lsi09G007310 vs. Swiss-Prot
Match: DCE2_ARATH (Glutamate decarboxylase 2 OS=Arabidopsis thaliana GN=GAD2 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.5e-14 Identity = 49/84 (58.33%), Postives = 56/84 (66.67%), Query Frame = 1
BLAST of Lsi09G007310 vs. Swiss-Prot
Match: DCE_PETHY (Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 6.4e-13 Identity = 46/90 (51.11%), Postives = 58/90 (64.44%), Query Frame = 1
BLAST of Lsi09G007310 vs. Swiss-Prot
Match: DCE1_ARATH (Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2) HSP 1 Score: 70.1 bits (170), Expect = 1.6e-11 Identity = 45/91 (49.45%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of Lsi09G007310 vs. TrEMBL
Match: A0A0A0KLK1_CUCSA (Glutamate decarboxylase OS=Cucumis sativus GN=Csa_5G100000 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.0e-37 Identity = 88/101 (87.13%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Lsi09G007310 vs. TrEMBL
Match: A0A0A0KPU6_CUCSA (Glutamate decarboxylase OS=Cucumis sativus GN=Csa_5G106010 PE=3 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 1.0e-25 Identity = 73/106 (68.87%), Postives = 83/106 (78.30%), Query Frame = 1
BLAST of Lsi09G007310 vs. TrEMBL
Match: B9HJL9_POPTR (Glutamate decarboxylase OS=Populus trichocarpa GN=POPTR_0008s14070g PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 3.9e-17 Identity = 58/94 (61.70%), Postives = 66/94 (70.21%), Query Frame = 1
BLAST of Lsi09G007310 vs. TrEMBL
Match: B9HVP9_POPTR (Glutamate decarboxylase OS=Populus trichocarpa GN=POPTR_0010s11070g PE=3 SV=2) HSP 1 Score: 94.0 bits (232), Expect = 1.1e-16 Identity = 58/90 (64.44%), Postives = 65/90 (72.22%), Query Frame = 1
BLAST of Lsi09G007310 vs. TrEMBL
Match: Q94KK8_TOBAC (Glutamate decarboxylase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.9e-16 Identity = 54/84 (64.29%), Postives = 61/84 (72.62%), Query Frame = 1
BLAST of Lsi09G007310 vs. TAIR10
Match: AT2G02010.1 (AT2G02010.1 glutamate decarboxylase 4) HSP 1 Score: 87.0 bits (214), Expect = 7.0e-18 Identity = 52/85 (61.18%), Postives = 61/85 (71.76%), Query Frame = 1
BLAST of Lsi09G007310 vs. TAIR10
Match: AT2G02000.1 (AT2G02000.1 glutamate decarboxylase 3) HSP 1 Score: 84.0 bits (206), Expect = 6.0e-17 Identity = 49/86 (56.98%), Postives = 56/86 (65.12%), Query Frame = 1
BLAST of Lsi09G007310 vs. TAIR10
Match: AT1G65960.2 (AT1G65960.2 glutamate decarboxylase 2) HSP 1 Score: 80.1 bits (196), Expect = 8.6e-16 Identity = 49/84 (58.33%), Postives = 56/84 (66.67%), Query Frame = 1
BLAST of Lsi09G007310 vs. TAIR10
Match: AT5G17330.1 (AT5G17330.1 glutamate decarboxylase) HSP 1 Score: 70.1 bits (170), Expect = 8.9e-13 Identity = 45/91 (49.45%), Postives = 57/91 (62.64%), Query Frame = 1
BLAST of Lsi09G007310 vs. TAIR10
Match: AT3G17760.1 (AT3G17760.1 glutamate decarboxylase 5) HSP 1 Score: 61.2 bits (147), Expect = 4.1e-10 Identity = 34/85 (40.00%), Postives = 55/85 (64.71%), Query Frame = 1
BLAST of Lsi09G007310 vs. NCBI nr
Match: gi|778698418|ref|XP_011654530.1| (PREDICTED: glutamate decarboxylase 4-like [Cucumis sativus]) HSP 1 Score: 162.9 bits (411), Expect = 2.9e-37 Identity = 88/101 (87.13%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Lsi09G007310 vs. NCBI nr
Match: gi|700194572|gb|KGN49749.1| (Glutamate decarboxylase [Cucumis sativus]) HSP 1 Score: 162.9 bits (411), Expect = 2.9e-37 Identity = 88/101 (87.13%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Lsi09G007310 vs. NCBI nr
Match: gi|659072700|ref|XP_008466806.1| (PREDICTED: glutamate decarboxylase 4-like [Cucumis melo]) HSP 1 Score: 161.8 bits (408), Expect = 6.4e-37 Identity = 87/101 (86.14%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Lsi09G007310 vs. NCBI nr
Match: gi|778698422|ref|XP_004151335.2| (PREDICTED: glutamate decarboxylase 4-like [Cucumis sativus]) HSP 1 Score: 124.0 bits (310), Expect = 1.5e-25 Identity = 73/106 (68.87%), Postives = 83/106 (78.30%), Query Frame = 1
BLAST of Lsi09G007310 vs. NCBI nr
Match: gi|659072698|ref|XP_008466797.1| (PREDICTED: LOW QUALITY PROTEIN: glutamate decarboxylase 4-like [Cucumis melo]) HSP 1 Score: 113.2 bits (282), Expect = 2.6e-22 Identity = 70/105 (66.67%), Postives = 79/105 (75.24%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|