Lsi08G006640 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGGGGGACAAGCGAAACATTCTTGATCATTTTCGCCGAGAGCTTGCTGCAAAGTTTGAGTTGAAGCGGAAGCTTTACAAAGCCATTTGCAACGATCCGAGTCTTCCTAACGATGTGCGTGAGGAGCAGCGTTATAAGCTGTCGAAATTGCCAAGAAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATTTTCACCGGTCGACCTAGGTCTGTCTACCAGCTTTTCCGTGTTTCTCGTATCGTTTTCCGCGATCTGGCGACCAAAGGTCTTATAATGGGTGTCAAGAAATCTTCTTGGTAG ATGTCGGGGGACAAGCGAAACATTCTTGATCATTTTCGCCGAGAGCTTGCTGCAAAGTTTGAGTTGAAGCGGAAGCTTTACAAAGCCATTTGCAACGATCCGAGTCTTCCTAACGATGTGCGTGAGGAGCAGCGTTATAAGCTGTCGAAATTGCCAAGAAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATTTTCACCGGTCGACCTAGGTCTGTCTACCAGCTTTTCCGTGTTTCTCGTATCGTTTTCCGCGATCTGGCGACCAAAGGTCTTATAATGGGTGTCAAGAAATCTTCTTGGTAG ATGTCGGGGGACAAGCGAAACATTCTTGATCATTTTCGCCGAGAGCTTGCTGCAAAGTTTGAGTTGAAGCGGAAGCTTTACAAAGCCATTTGCAACGATCCGAGTCTTCCTAACGATGTGCGTGAGGAGCAGCGTTATAAGCTGTCGAAATTGCCAAGAAATAGTTCGTTCACTCGACTGAGGAATCGCTGCATTTTCACCGGTCGACCTAGGTCTGTCTACCAGCTTTTCCGTGTTTCTCGTATCGTTTTCCGCGATCTGGCGACCAAAGGTCTTATAATGGGTGTCAAGAAATCTTCTTGGTAG MSGDKRNILDHFRRELAAKFELKRKLYKAICNDPSLPNDVREEQRYKLSKLPRNSSFTRLRNRCIFTGRPRSVYQLFRVSRIVFRDLATKGLIMGVKKSSW
BLAST of Lsi08G006640 vs. Swiss-Prot
Match: RT14_OENBE (Ribosomal protein S14, mitochondrial OS=Oenothera berteroana GN=RPS14 PE=3 SV=2) HSP 1 Score: 155.6 bits (392), Expect = 2.9e-37 Identity = 72/98 (73.47%), Postives = 87/98 (88.78%), Query Frame = 1
BLAST of Lsi08G006640 vs. Swiss-Prot
Match: RT14_VICFA (Ribosomal protein S14, mitochondrial OS=Vicia faba GN=RPS14 PE=3 SV=2) HSP 1 Score: 152.5 bits (384), Expect = 2.4e-36 Identity = 72/98 (73.47%), Postives = 86/98 (87.76%), Query Frame = 1
BLAST of Lsi08G006640 vs. Swiss-Prot
Match: RT14_BRANA (Ribosomal protein S14, mitochondrial OS=Brassica napus GN=RPS14 PE=3 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.7e-34 Identity = 69/98 (70.41%), Postives = 83/98 (84.69%), Query Frame = 1
BLAST of Lsi08G006640 vs. Swiss-Prot
Match: RT14_MARPO (Ribosomal protein S14, mitochondrial OS=Marchantia polymorpha GN=RPS14 PE=3 SV=2) HSP 1 Score: 136.0 bits (341), Expect = 2.3e-31 Identity = 66/94 (70.21%), Postives = 78/94 (82.98%), Query Frame = 1
BLAST of Lsi08G006640 vs. Swiss-Prot
Match: RT14_PROWI (Ribosomal protein S14, mitochondrial OS=Prototheca wickerhamii GN=RPS14 PE=3 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.4e-20 Identity = 52/89 (58.43%), Postives = 64/89 (71.91%), Query Frame = 1
BLAST of Lsi08G006640 vs. TrEMBL
Match: A0A0A0LSR8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G386130 PE=4 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 1.2e-42 Identity = 86/101 (85.15%), Postives = 95/101 (94.06%), Query Frame = 1
BLAST of Lsi08G006640 vs. TrEMBL
Match: V9VFW3_AMBTC (Ribosomal protein S14 OS=Amborella trichopoda GN=rps14 PE=2 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 6.4e-36 Identity = 73/98 (74.49%), Postives = 87/98 (88.78%), Query Frame = 1
BLAST of Lsi08G006640 vs. TrEMBL
Match: A0A0M5L7R7_9MAGN (Ribosomal protein S14 OS=Heuchera parviflora var. saurensis GN=rps14 PE=4 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 8.4e-36 Identity = 73/98 (74.49%), Postives = 87/98 (88.78%), Query Frame = 1
BLAST of Lsi08G006640 vs. TrEMBL
Match: Q0QG47_JUNEF (Ribosomal protein S14 OS=Juncus effusus PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.1e-35 Identity = 72/98 (73.47%), Postives = 88/98 (89.80%), Query Frame = 1
BLAST of Lsi08G006640 vs. TrEMBL
Match: A0A0J8CR24_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_3g051900 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.4e-35 Identity = 72/99 (72.73%), Postives = 90/99 (90.91%), Query Frame = 1
BLAST of Lsi08G006640 vs. TAIR10
Match: AT2G34520.1 (AT2G34520.1 mitochondrial ribosomal protein S14) HSP 1 Score: 148.3 bits (373), Expect = 2.6e-36 Identity = 70/99 (70.71%), Postives = 84/99 (84.85%), Query Frame = 1
BLAST of Lsi08G006640 vs. TAIR10
Match: ATCG00330.1 (ATCG00330.1 chloroplast ribosomal protein S14) HSP 1 Score: 54.3 bits (129), Expect = 5.1e-08 Identity = 35/90 (38.89%), Postives = 50/90 (55.56%), Query Frame = 1
BLAST of Lsi08G006640 vs. NCBI nr
Match: gi|659113442|ref|XP_008456576.1| (PREDICTED: ribosomal protein S14, mitochondrial [Cucumis melo]) HSP 1 Score: 183.0 bits (463), Expect = 2.7e-43 Identity = 87/101 (86.14%), Postives = 96/101 (95.05%), Query Frame = 1
BLAST of Lsi08G006640 vs. NCBI nr
Match: gi|778672795|ref|XP_011649873.1| (PREDICTED: ribosomal protein S14, mitochondrial [Cucumis sativus]) HSP 1 Score: 180.3 bits (456), Expect = 1.7e-42 Identity = 86/101 (85.15%), Postives = 95/101 (94.06%), Query Frame = 1
BLAST of Lsi08G006640 vs. NCBI nr
Match: gi|557954302|gb|AHA47122.1| (ribosomal protein S14 (mitochondrion) [Amborella trichopoda]) HSP 1 Score: 157.9 bits (398), Expect = 9.2e-36 Identity = 73/98 (74.49%), Postives = 87/98 (88.78%), Query Frame = 1
BLAST of Lsi08G006640 vs. NCBI nr
Match: gi|927682216|gb|ALE29228.1| (ribosomal protein S14 (mitochondrion) [Heuchera parviflora var. saurensis]) HSP 1 Score: 157.5 bits (397), Expect = 1.2e-35 Identity = 73/98 (74.49%), Postives = 87/98 (88.78%), Query Frame = 1
BLAST of Lsi08G006640 vs. NCBI nr
Match: gi|88193119|gb|ABD42934.1| (ribosomal protein S14 (mitochondrion) [Juncus effusus]) HSP 1 Score: 157.1 bits (396), Expect = 1.6e-35 Identity = 72/98 (73.47%), Postives = 88/98 (89.80%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |