Lsi05G007770 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGGAAGCAGGAGTTCATTTTGGTCATGGTACTAGGAAATGGAATCCTAGAATGGCACCTTATATCTCTGCAAAACGTAAAGGTATTCATATTATAAATCTTACTAGAACTGCTCGTTTTTTATCAGAAGCTTGTGATTTAGTTTTTGATGCAGCAAGTAGGGGCAAACAATTCTTAATTGTTGGTACCAAAAATAAAGCAGCGGATTCAGTAGCCCGGGCTGCAACAAGGGCTCGGTGTCATTATGTTAATAAAAAATGGCTCGGGGGGATGTTAACAAATTGGTCTACTACAGAAACGAGACTTCATAAGTTCAGGGACTTGAGAACGGAACAAAGAGCAAAGAGCCAGAGAAACTTTCGAGTTATGAATCGGGAATAA ATGATGGAAGCAGGAGTTCATTTTGGTCATGGTACTAGGAAATGGAATCCTAGAATGGCACCTTATATCTCTGCAAAACGTAAAGGTATTCATATTATAAATCTTACTAGAACTGCTCGTTTTTTATCAGAAGCTTGTGATTTAGTTTTTGATGCAGCAAGTAGGGGCAAACAATTCTTAATTGTTGGTACCAAAAATAAAGCAGCGGATTCAGTAGCCCGGGCTGCAACAAGGGCTCGGTGTCATTATGTTAATAAAAAATGGCTCGGGGGGATGTTAACAAATTGGTCTACTACAGAAACGAGACTTCATAAGTTCAGGGACTTGAGAACGGAACAAAGAGCAAAGAGCCAGAGAAACTTTCGAGTTATGAATCGGGAATAA ATGATGGAAGCAGGAGTTCATTTTGGTCATGGTACTAGGAAATGGAATCCTAGAATGGCACCTTATATCTCTGCAAAACGTAAAGGTATTCATATTATAAATCTTACTAGAACTGCTCGTTTTTTATCAGAAGCTTGTGATTTAGTTTTTGATGCAGCAAGTAGGGGCAAACAATTCTTAATTGTTGGTACCAAAAATAAAGCAGCGGATTCAGTAGCCCGGGCTGCAACAAGGGCTCGGTGTCATTATGTTAATAAAAAATGGCTCGGGGGGATGTTAACAAATTGGTCTACTACAGAAACGAGACTTCATAAGTTCAGGGACTTGAGAACGGAACAAAGAGCAAAGAGCCAGAGAAACTTTCGAGTTATGAATCGGGAATAA MMEAGVHFGHGTRKWNPRMAPYISAKRKGIHIINLTRTARFLSEACDLVFDAASRGKQFLIVGTKNKAADSVARAATRARCHYVNKKWLGGMLTNWSTTETRLHKFRDLRTEQRAKSQRNFRVMNRE
BLAST of Lsi05G007770 vs. Swiss-Prot
Match: RR2_CUCSA (30S ribosomal protein S2, chloroplastic OS=Cucumis sativus GN=rps2 PE=3 SV=1) HSP 1 Score: 233.0 bits (593), Expect = 1.8e-60 Identity = 111/114 (97.37%), Postives = 113/114 (99.12%), Query Frame = 1
BLAST of Lsi05G007770 vs. Swiss-Prot
Match: RR2_EUCGG (30S ribosomal protein S2, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=rps2 PE=3 SV=1) HSP 1 Score: 232.3 bits (591), Expect = 3.0e-60 Identity = 111/115 (96.52%), Postives = 113/115 (98.26%), Query Frame = 1
BLAST of Lsi05G007770 vs. Swiss-Prot
Match: RR2_CARPA (30S ribosomal protein S2, chloroplastic OS=Carica papaya GN=rps2 PE=3 SV=1) HSP 1 Score: 231.5 bits (589), Expect = 5.2e-60 Identity = 111/114 (97.37%), Postives = 112/114 (98.25%), Query Frame = 1
BLAST of Lsi05G007770 vs. Swiss-Prot
Match: RR2_RANMC (30S ribosomal protein S2, chloroplastic OS=Ranunculus macranthus GN=rps2 PE=3 SV=1) HSP 1 Score: 229.2 bits (583), Expect = 2.6e-59 Identity = 110/114 (96.49%), Postives = 111/114 (97.37%), Query Frame = 1
BLAST of Lsi05G007770 vs. Swiss-Prot
Match: RR2_VITVI (30S ribosomal protein S2, chloroplastic OS=Vitis vinifera GN=rps2 PE=3 SV=1) HSP 1 Score: 228.0 bits (580), Expect = 5.7e-59 Identity = 109/114 (95.61%), Postives = 111/114 (97.37%), Query Frame = 1
BLAST of Lsi05G007770 vs. TrEMBL
Match: X2FAM2_LAGSI (30S ribosomal protein S2, chloroplastic OS=Lagenaria siceraria GN=rps2 PE=3 SV=1) HSP 1 Score: 235.7 bits (600), Expect = 3.0e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. TrEMBL
Match: A0A0S2IH71_CUCPE (Ribosomal protein S2 OS=Cucurbita pepo subsp. pepo GN=rps2 PE=3 SV=1) HSP 1 Score: 235.7 bits (600), Expect = 3.0e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. TrEMBL
Match: A0A0S2IG98_9ROSI (Ribosomal protein S2 OS=Cucurbita andreana GN=rps2 PE=3 SV=1) HSP 1 Score: 235.7 bits (600), Expect = 3.0e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. TrEMBL
Match: A0A0S2IE57_9ROSI (Ribosomal protein S2 OS=Cucurbita argyrosperma GN=rps2 PE=3 SV=1) HSP 1 Score: 235.7 bits (600), Expect = 3.0e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. TrEMBL
Match: A0A0S2IFG5_9ROSI (Ribosomal protein S2 OS=Cucurbita ecuadorensis GN=rps2 PE=3 SV=1) HSP 1 Score: 235.7 bits (600), Expect = 3.0e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. TAIR10
Match: ATCG00160.1 (ATCG00160.1 ribosomal protein S2) HSP 1 Score: 224.6 bits (571), Expect = 3.6e-59 Identity = 111/132 (84.09%), Postives = 118/132 (89.39%), Query Frame = 1
BLAST of Lsi05G007770 vs. NCBI nr
Match: gi|1002166186|ref|YP_009236269.1| (ribosomal protein S2 (chloroplast) [Gynostemma pentaphyllum]) HSP 1 Score: 235.7 bits (600), Expect = 4.4e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. NCBI nr
Match: gi|952954554|gb|ALO21915.1| (ribosomal protein S2 (plastid) [Cucurbita cordata]) HSP 1 Score: 235.7 bits (600), Expect = 4.4e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. NCBI nr
Match: gi|595645475|gb|AHM88934.1| (ribosomal protein S2, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 235.7 bits (600), Expect = 4.4e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. NCBI nr
Match: gi|952954376|gb|ALO21740.1| (ribosomal protein S2 (plastid) [Cucurbita argyrosperma]) HSP 1 Score: 235.7 bits (600), Expect = 4.4e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Lsi05G007770 vs. NCBI nr
Match: gi|595647815|gb|AHM91235.1| (ribosomal protein S2 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 235.7 bits (600), Expect = 4.4e-59 Identity = 113/114 (99.12%), Postives = 114/114 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|