Lsi04G004610 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGCAATGTTTTGGTAAAAAAATTATATATTTCACGAATATATTATAATTAATCTCCTAAATATATAAAAAAAAGATTAAGTAAACTGGTTGCAATGTTTTGGAGGTCAATGGAGAAGTTCACGAATTCTTTGTAGGAGACAAGTCTCACCCGCGTTATGACGCCATCGAAACGATATGGGGAGAGATTTCTAAACGGCTAAAGTTAGTAGGATACGTCGCAAATACTAACCCTGTTCTCTTTGATATAGAAGAAGAAAAGGAAGATGCTTTGTGTAAACATAGCGAGAAGATGGCCATTGCATTTGGATTGATTAGTCTGAAGGAGGGGTTGCCCATTAGAATAGTGAAGAACCTCAGAGTTTGTTGGGATTGCCATGATGTTACAAAGATGATATCTAAAATTTTTAACAGGGAGATTATTGTGAGAGATAGGAACAGATTTCACCATTTTAAAGATGGCGAGTGTTCTTGTAAGGATTTTTGGTGA ATGTGCAATGTCAATGGAGAAGTTCACGAATTCTTTGTAGGAGACAAGTCTCACCCGCGTTATGACGCCATCGAAACGATATGGGGAGAGATTTCTAAACGGCTAAAGTTAGTAGGATACGTCGCAAATACTAACCCTGTTCTCTTTGATATAGAAGAAGAAAAGGAAGATGCTTTGTGTAAACATAGCGAGAAGATGGCCATTGCATTTGGATTGATTAGTCTGAAGGAGGGGTTGCCCATTAGAATAGTGAAGAACCTCAGAGTTTGTTGGGATTGCCATGATGTTACAAAGATGATATCTAAAATTTTTAACAGGGAGATTATTGTGAGAGATAGGAACAGATTTCACCATTTTAAAGATGGCGAGTGTTCTTGTAAGGATTTTTGGTGA ATGTGCAATGTCAATGGAGAAGTTCACGAATTCTTTGTAGGAGACAAGTCTCACCCGCGTTATGACGCCATCGAAACGATATGGGGAGAGATTTCTAAACGGCTAAAGTTAGTAGGATACGTCGCAAATACTAACCCTGTTCTCTTTGATATAGAAGAAGAAAAGGAAGATGCTTTGTGTAAACATAGCGAGAAGATGGCCATTGCATTTGGATTGATTAGTCTGAAGGAGGGGTTGCCCATTAGAATAGTGAAGAACCTCAGAGTTTGTTGGGATTGCCATGATGTTACAAAGATGATATCTAAAATTTTTAACAGGGAGATTATTGTGAGAGATAGGAACAGATTTCACCATTTTAAAGATGGCGAGTGTTCTTGTAAGGATTTTTGGTGA MCNVNGEVHEFFVGDKSHPRYDAIETIWGEISKRLKLVGYVANTNPVLFDIEEEKEDALCKHSEKMAIAFGLISLKEGLPIRIVKNLRVCWDCHDVTKMISKIFNREIIVRDRNRFHHFKDGECSCKDFW
BLAST of Lsi04G004610 vs. Swiss-Prot
Match: PP410_ARATH (Putative pentatricopeptide repeat-containing protein At5g40405 OS=Arabidopsis thaliana GN=PCMP-H14 PE=3 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 7.9e-56 Identity = 99/128 (77.34%), Postives = 111/128 (86.72%), Query Frame = 1
BLAST of Lsi04G004610 vs. Swiss-Prot
Match: PP354_ARATH (Pentatricopeptide repeat-containing protein ELI1, chloroplastic OS=Arabidopsis thaliana GN=ELI1 PE=3 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 6.1e-40 Identity = 77/128 (60.16%), Postives = 96/128 (75.00%), Query Frame = 1
BLAST of Lsi04G004610 vs. Swiss-Prot
Match: PP295_ARATH (Pentatricopeptide repeat-containing protein At3g62890 OS=Arabidopsis thaliana GN=PCMP-H82 PE=2 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 3.9e-39 Identity = 75/128 (58.59%), Postives = 95/128 (74.22%), Query Frame = 1
BLAST of Lsi04G004610 vs. Swiss-Prot
Match: PP224_ARATH (Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 5.1e-39 Identity = 75/128 (58.59%), Postives = 93/128 (72.66%), Query Frame = 1
BLAST of Lsi04G004610 vs. Swiss-Prot
Match: PP330_ARATH (Pentatricopeptide repeat-containing protein At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2) HSP 1 Score: 161.4 bits (407), Expect = 6.7e-39 Identity = 75/131 (57.25%), Postives = 96/131 (73.28%), Query Frame = 1
BLAST of Lsi04G004610 vs. TrEMBL
Match: A0A0A0KSJ7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G604190 PE=4 SV=1) HSP 1 Score: 251.1 bits (640), Expect = 7.2e-64 Identity = 116/128 (90.62%), Postives = 120/128 (93.75%), Query Frame = 1
BLAST of Lsi04G004610 vs. TrEMBL
Match: M5XCT1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa003120mg PE=4 SV=1) HSP 1 Score: 243.0 bits (619), Expect = 2.0e-61 Identity = 112/128 (87.50%), Postives = 121/128 (94.53%), Query Frame = 1
BLAST of Lsi04G004610 vs. TrEMBL
Match: V4SVA4_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10030908mg PE=4 SV=1) HSP 1 Score: 238.4 bits (607), Expect = 4.8e-60 Identity = 107/128 (83.59%), Postives = 120/128 (93.75%), Query Frame = 1
BLAST of Lsi04G004610 vs. TrEMBL
Match: A0A067H5C2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g012539mg PE=4 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 1.5e-58 Identity = 105/128 (82.03%), Postives = 119/128 (92.97%), Query Frame = 1
BLAST of Lsi04G004610 vs. TrEMBL
Match: W9R9L3_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_021080 PE=4 SV=1) HSP 1 Score: 232.3 bits (591), Expect = 3.4e-58 Identity = 105/128 (82.03%), Postives = 118/128 (92.19%), Query Frame = 1
BLAST of Lsi04G004610 vs. TAIR10
Match: AT5G40405.1 (AT5G40405.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 217.6 bits (553), Expect = 4.4e-57 Identity = 99/128 (77.34%), Postives = 111/128 (86.72%), Query Frame = 1
BLAST of Lsi04G004610 vs. TAIR10
Match: AT4G37380.1 (AT4G37380.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 164.9 bits (416), Expect = 3.4e-41 Identity = 77/128 (60.16%), Postives = 96/128 (75.00%), Query Frame = 1
BLAST of Lsi04G004610 vs. TAIR10
Match: AT3G62890.1 (AT3G62890.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 162.2 bits (409), Expect = 2.2e-40 Identity = 75/128 (58.59%), Postives = 95/128 (74.22%), Query Frame = 1
BLAST of Lsi04G004610 vs. TAIR10
Match: AT3G12770.1 (AT3G12770.1 mitochondrial editing factor 22) HSP 1 Score: 161.8 bits (408), Expect = 2.9e-40 Identity = 75/128 (58.59%), Postives = 93/128 (72.66%), Query Frame = 1
BLAST of Lsi04G004610 vs. TAIR10
Match: AT4G21065.1 (AT4G21065.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 161.4 bits (407), Expect = 3.8e-40 Identity = 75/131 (57.25%), Postives = 96/131 (73.28%), Query Frame = 1
BLAST of Lsi04G004610 vs. NCBI nr
Match: gi|659090971|ref|XP_008446300.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Cucumis melo]) HSP 1 Score: 258.5 bits (659), Expect = 6.4e-66 Identity = 121/128 (94.53%), Postives = 123/128 (96.09%), Query Frame = 1
BLAST of Lsi04G004610 vs. NCBI nr
Match: gi|449435364|ref|XP_004135465.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Cucumis sativus]) HSP 1 Score: 251.1 bits (640), Expect = 1.0e-63 Identity = 116/128 (90.62%), Postives = 120/128 (93.75%), Query Frame = 1
BLAST of Lsi04G004610 vs. NCBI nr
Match: gi|700196697|gb|KGN51874.1| (hypothetical protein Csa_5G604190 [Cucumis sativus]) HSP 1 Score: 251.1 bits (640), Expect = 1.0e-63 Identity = 116/128 (90.62%), Postives = 120/128 (93.75%), Query Frame = 1
BLAST of Lsi04G004610 vs. NCBI nr
Match: gi|657994461|ref|XP_008389535.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Malus domestica]) HSP 1 Score: 246.1 bits (627), Expect = 3.3e-62 Identity = 113/128 (88.28%), Postives = 122/128 (95.31%), Query Frame = 1
BLAST of Lsi04G004610 vs. NCBI nr
Match: gi|694361392|ref|XP_009360403.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At5g40405 [Pyrus x bretschneideri]) HSP 1 Score: 246.1 bits (627), Expect = 3.3e-62 Identity = 113/128 (88.28%), Postives = 123/128 (96.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |