Cucsa.340980 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GCTGTTAAAGGTGTTAAAGAAGAAGAATTCTATAGAGGTATGAGGAAAATAGGGTCAAGTCCACCCAGCTGTGAGCACAAGTGCTATGGATGCATTCCATGTGAAGCCATTCAAGTGCCTACAACCACCAACAGGCGCAGCCACGTAGGGGTCCAATACACTAACTATGAACCCGAGGGATGGAAATGCAAGTGTGGCCCTTCCTTTTACAGCCCTTGA GCTGTTAAAGGTGTTAAAGAAGAAGAATTCTATAGAGGTATGAGGAAAATAGGGTCAAGTCCACCCAGCTGTGAGCACAAGTGCTATGGATGCATTCCATGTGAAGCCATTCAAGTGCCTACAACCACCAACAGGCGCAGCCACGTAGGGGTCCAATACACTAACTATGAACCCGAGGGATGGAAATGCAAGTGTGGCCCTTCCTTTTACAGCCCTTGA GCTGTTAAAGGTGTTAAAGAAGAAGAATTCTATAGAGGTATGAGGAAAATAGGGTCAAGTCCACCCAGCTGTGAGCACAAGTGCTATGGATGCATTCCATGTGAAGCCATTCAAGTGCCTACAACCACCAACAGGCGCAGCCACGTAGGGGTCCAATACACTAACTATGAACCCGAGGGATGGAAATGCAAGTGTGGCCCTTCCTTTTACAGCCCTTGA AVKGVKEEEFYRGMRKIGSSPPSCEHKCYGCIPCEAIQVPTTTNRRSHVGVQYTNYEPEGWKCKCGPSFYSP*
BLAST of Cucsa.340980 vs. Swiss-Prot
Match: EPFL3_ARATH (EPIDERMAL PATTERNING FACTOR-like protein 3 OS=Arabidopsis thaliana GN=EPFL3 PE=1 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.7e-16 Identity = 35/61 (57.38%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of Cucsa.340980 vs. Swiss-Prot
Match: EPFL1_ARATH (EPIDERMAL PATTERNING FACTOR-like protein 1 OS=Arabidopsis thaliana GN=EPFL1 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 9.7e-11 Identity = 31/76 (40.79%), Postives = 39/76 (51.32%), Query Frame = 1
BLAST of Cucsa.340980 vs. Swiss-Prot
Match: EPFL4_ARATH (EPIDERMAL PATTERNING FACTOR-like protein 4 OS=Arabidopsis thaliana GN=EPFL4 PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.5e-06 Identity = 22/55 (40.00%), Postives = 28/55 (50.91%), Query Frame = 1
BLAST of Cucsa.340980 vs. TrEMBL
Match: A0A0A0LCQ8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G847610 PE=4 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 5.0e-38 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 1
BLAST of Cucsa.340980 vs. TrEMBL
Match: A0A0B2RE08_GLYSO (EPIDERMAL PATTERNING FACTOR-like protein 3 OS=Glycine soja GN=glysoja_022383 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 2.7e-28 Identity = 56/71 (78.87%), Postives = 64/71 (90.14%), Query Frame = 1
BLAST of Cucsa.340980 vs. TrEMBL
Match: K7M960_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_15G025200 PE=4 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 2.7e-28 Identity = 56/71 (78.87%), Postives = 64/71 (90.14%), Query Frame = 1
BLAST of Cucsa.340980 vs. TrEMBL
Match: A0A0S3SZJ6_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.09G202600 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.4e-27 Identity = 52/66 (78.79%), Postives = 60/66 (90.91%), Query Frame = 1
BLAST of Cucsa.340980 vs. TrEMBL
Match: A0A0L9TIG1_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan1082s003300 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.4e-27 Identity = 52/66 (78.79%), Postives = 60/66 (90.91%), Query Frame = 1
BLAST of Cucsa.340980 vs. TAIR10
Match: AT3G13898.1 (AT3G13898.1 unknown protein) HSP 1 Score: 84.0 bits (206), Expect = 4.3e-17 Identity = 35/61 (57.38%), Postives = 43/61 (70.49%), Query Frame = 1
BLAST of Cucsa.340980 vs. TAIR10
Match: AT5G10310.1 (AT5G10310.1 unknown protein) HSP 1 Score: 67.0 bits (162), Expect = 5.5e-12 Identity = 31/76 (40.79%), Postives = 39/76 (51.32%), Query Frame = 1
BLAST of Cucsa.340980 vs. TAIR10
Match: AT4G14723.1 (AT4G14723.1 BEST Arabidopsis thaliana protein match is: allergen-related (TAIR:AT3G22820.1)) HSP 1 Score: 52.4 bits (124), Expect = 1.4e-07 Identity = 22/55 (40.00%), Postives = 28/55 (50.91%), Query Frame = 1
BLAST of Cucsa.340980 vs. NCBI nr
Match: gi|449458149|ref|XP_004146810.1| (PREDICTED: EPIDERMAL PATTERNING FACTOR-like protein 3 [Cucumis sativus]) HSP 1 Score: 164.5 bits (415), Expect = 7.1e-38 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 1
BLAST of Cucsa.340980 vs. NCBI nr
Match: gi|700204667|gb|KGN59800.1| (hypothetical protein Csa_3G847610 [Cucumis sativus]) HSP 1 Score: 164.5 bits (415), Expect = 7.1e-38 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 1
BLAST of Cucsa.340980 vs. NCBI nr
Match: gi|659093602|ref|XP_008447616.1| (PREDICTED: EPIDERMAL PATTERNING FACTOR-like protein 3 [Cucumis melo]) HSP 1 Score: 163.7 bits (413), Expect = 1.2e-37 Identity = 70/72 (97.22%), Postives = 72/72 (100.00%), Query Frame = 1
BLAST of Cucsa.340980 vs. NCBI nr
Match: gi|955371936|ref|XP_014623502.1| (PREDICTED: EPIDERMAL PATTERNING FACTOR-like protein 1 [Glycine max]) HSP 1 Score: 132.1 bits (331), Expect = 3.9e-28 Identity = 56/71 (78.87%), Postives = 64/71 (90.14%), Query Frame = 1
BLAST of Cucsa.340980 vs. NCBI nr
Match: gi|951031833|ref|XP_014515251.1| (PREDICTED: EPIDERMAL PATTERNING FACTOR-like protein 3 [Vigna radiata var. radiata]) HSP 1 Score: 129.8 bits (325), Expect = 1.9e-27 Identity = 52/66 (78.79%), Postives = 60/66 (90.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|