Cucsa.291560 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGTCATGGTTGATATGTGTGGTGTTTATTAGCATGTTGGTGATGAGCCAAGAAGTTGGAGCACAGACAAACCATCTTAAATTTCCTAATCCATGCGATCTTCCTTCTCCACCTCCAAGTTGTTCGTCAAAAGTTAAAGATCATGCTCCTACTAATCCCTATGATAGAGGTTGCTCTGCAATTCATCGATGTCGTGGAGATTGA ATGAAGTCATGGTTGATATGTGTGGTGTTTATTAGCATGTTGGTGATGAGCCAAGAAGTTGGAGCACAGACAAACCATCTTAAATTTCCTAATCCATGCGATCTTCCTTCTCCACCTCCAAGTTGTTCGTCAAAAGTTAAAGATCATGCTCCTACTAATCCCTATGATAGAGGTTGCTCTGCAATTCATCGATGTCGTGGAGATTGA ATGAAGTCATGGTTGATATGTGTGGTGTTTATTAGCATGTTGGTGATGAGCCAAGAAGTTGGAGCACAGACAAACCATCTTAAATTTCCTAATCCATGCGATCTTCCTTCTCCACCTCCAAGTTGTTCGTCAAAAGTTAAAGATCATGCTCCTACTAATCCCTATGATAGAGGTTGCTCTGCAATTCATCGATGTCGTGGAGATTGA MKSWLICVVFISMLVMSQEVGAQTNHLKFPNPCDLPSPPPSCSSKVKDHAPTNPYDRGCSAIHRCRGD*
BLAST of Cucsa.291560 vs. Swiss-Prot
Match: RLF11_ARATH (Protein RALF-like 11 OS=Arabidopsis thaliana GN=RALFL11 PE=3 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.0e-09 Identity = 31/73 (42.47%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Cucsa.291560 vs. Swiss-Prot
Match: RLF13_ARATH (Protein RALF-like 13 OS=Arabidopsis thaliana GN=RALFL13 PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 3.8e-09 Identity = 30/73 (41.10%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Cucsa.291560 vs. Swiss-Prot
Match: RLF12_ARATH (Protein RALF-like 12 OS=Arabidopsis thaliana GN=RALFL12 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.3e-08 Identity = 29/73 (39.73%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Cucsa.291560 vs. Swiss-Prot
Match: RLF10_ARATH (Protein RALF-like 10 OS=Arabidopsis thaliana GN=RALFL10 PE=2 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 5.2e-06 Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 1
BLAST of Cucsa.291560 vs. TrEMBL
Match: A0A0A0M0X3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G690160 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 3.1e-34 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of Cucsa.291560 vs. TrEMBL
Match: A0A0A0LI94_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G191310 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 6.6e-16 Identity = 41/67 (61.19%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Cucsa.291560 vs. TrEMBL
Match: A0A0A0LZK3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G610770 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.7e-11 Identity = 38/67 (56.72%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of Cucsa.291560 vs. TrEMBL
Match: B2Y4P5_ARAHH (Putative rapid alkalinization factor (RALF) family protein OS=Arabidopsis halleri subsp. halleri GN=7C17.2 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.3e-07 Identity = 29/73 (39.73%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Cucsa.291560 vs. TrEMBL
Match: D7L1Y5_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_900340 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.3e-07 Identity = 29/73 (39.73%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Cucsa.291560 vs. TAIR10
Match: AT2G19030.1 (AT2G19030.1 ralf-like 11) HSP 1 Score: 63.5 bits (153), Expect = 5.7e-11 Identity = 31/73 (42.47%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Cucsa.291560 vs. TAIR10
Match: AT2G19045.1 (AT2G19045.1 RALF-like 13) HSP 1 Score: 61.6 bits (148), Expect = 2.2e-10 Identity = 30/73 (41.10%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Cucsa.291560 vs. TAIR10
Match: AT2G19040.1 (AT2G19040.1 RALF-like 12) HSP 1 Score: 58.5 bits (140), Expect = 1.8e-09 Identity = 29/73 (39.73%), Postives = 48/73 (65.75%), Query Frame = 1
BLAST of Cucsa.291560 vs. TAIR10
Match: AT2G19020.1 (AT2G19020.1 ralf-like 10) HSP 1 Score: 51.2 bits (121), Expect = 2.9e-07 Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 1
BLAST of Cucsa.291560 vs. NCBI nr
Match: gi|700211681|gb|KGN66777.1| (hypothetical protein Csa_1G690160 [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 4.5e-34 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of Cucsa.291560 vs. NCBI nr
Match: gi|700206506|gb|KGN61625.1| (hypothetical protein Csa_2G191310 [Cucumis sativus]) HSP 1 Score: 90.9 bits (224), Expect = 9.5e-16 Identity = 41/67 (61.19%), Postives = 51/67 (76.12%), Query Frame = 1
BLAST of Cucsa.291560 vs. NCBI nr
Match: gi|659102875|ref|XP_008452361.1| (PREDICTED: uncharacterized protein LOC103493422 [Cucumis melo]) HSP 1 Score: 76.3 bits (186), Expect = 2.4e-11 Identity = 35/58 (60.34%), Postives = 42/58 (72.41%), Query Frame = 1
BLAST of Cucsa.291560 vs. NCBI nr
Match: gi|700211353|gb|KGN66449.1| (hypothetical protein Csa_1G610770 [Cucumis sativus]) HSP 1 Score: 76.3 bits (186), Expect = 2.4e-11 Identity = 38/67 (56.72%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of Cucsa.291560 vs. NCBI nr
Match: gi|15224701|ref|NP_179493.1| (protein RALF-like 11 [Arabidopsis thaliana]) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-07 Identity = 31/73 (42.47%), Postives = 48/73 (65.75%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|