Cucsa.244650 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCGTCTGTACACCCCGACATCGATCGGGTGAAAGGTCCGTGGAGTCCGGAAGAGGACCTCTTACTTCGAATGCTAGTCCAGGATCAAGGCGCTCGGAACTGGTCTCTTATCAGTCAATCCATTCACGGCCGCTCCGGAAAATCCTGCCGTTTACGCTGGTTTAATCAGCTATGTCCTGGGCTGGACCGTCGTCCTTTCACGCCAGAAGAGGACGCATTCATCGTGGATGCACATCGTATTTACGGAAACAAATGGGCGACCATCGCCAGGCTTTTGAATGGACGAACCGACAATGCGATTAAGAATCACTGGAATTCGACATTGAAACGGAAGTATG ATGCCGTCTGTACACCCCGACATCGATCGGGTGAAAGGTCCGTGGAGTCCGGAAGAGGACCTCTTACTTCGAATGCTAGTCCAGGATCAAGGCGCTCGGAACTGGTCTCTTATCAGTCAATCCATTCACGGCCGCTCCGGAAAATCCTGCCGTTTACGCTGGTTTAATCAGCTATGTCCTGGGCTGGACCGTCGTCCTTTCACGCCAGAAGAGGACGCATTCATCGTGGATGCACATCGTATTTACGGAAACAAATGGGCGACCATCGCCAGGCTTTTGAATGGACGAACCGACAATGCGATTAAGAATCACTGGAATTCGACATTGAAACGGAAGTATG ATGCCGTCTGTACACCCCGACATCGATCGGGTGAAAGGTCCGTGGAGTCCGGAAGAGGACCTCTTACTTCGAATGCTAGTCCAGGATCAAGGCGCTCGGAACTGGTCTCTTATCAGTCAATCCATTCACGGCCGCTCCGGAAAATCCTGCCGTTTACGCTGGTTTAATCAGCTATGTCCTGGGCTGGACCGTCGTCCTTTCACGCCAGAAGAGGACGCATTCATCGTGGATGCACATCGTATTTACGGAAACAAATGGGCGACCATCGCCAGGCTTTTGAATGGACGAACCGACAATGCGATTAAGAATCACTGGAATTCGACATTGAAACGGAAGTATG MPSVHPDIDRVKGPWSPEEDLLLRMLVQDQGARNWSLISQSIHGRSGKSCRLRWFNQLCPGLDRRPFTPEEDAFIVDAHRIYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYX
BLAST of Cucsa.244650 vs. Swiss-Prot
Match: MYB44_ARATH (Transcription factor MYB44 OS=Arabidopsis thaliana GN=MYB44 PE=2 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.5e-39 Identity = 76/104 (73.08%), Postives = 85/104 (81.73%), Query Frame = 1
BLAST of Cucsa.244650 vs. Swiss-Prot
Match: MYBB_XENLA (Myb-related protein B OS=Xenopus laevis GN=mybl2 PE=2 SV=2) HSP 1 Score: 131.7 bits (330), Expect = 5.0e-30 Identity = 59/109 (54.13%), Postives = 79/109 (72.48%), Query Frame = 1
HSP 2 Score: 79.0 bits (193), Expect = 3.8e-14 Identity = 38/105 (36.19%), Postives = 59/105 (56.19%), Query Frame = 1
BLAST of Cucsa.244650 vs. Swiss-Prot
Match: MYBB_CHICK (Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 4.2e-29 Identity = 57/104 (54.81%), Postives = 75/104 (72.12%), Query Frame = 1
BLAST of Cucsa.244650 vs. Swiss-Prot
Match: MYBB_HUMAN (Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.2e-28 Identity = 56/104 (53.85%), Postives = 75/104 (72.12%), Query Frame = 1
HSP 2 Score: 70.1 bits (170), Expect = 1.8e-11 Identity = 34/101 (33.66%), Postives = 54/101 (53.47%), Query Frame = 1
BLAST of Cucsa.244650 vs. Swiss-Prot
Match: MYBB_MOUSE (Myb-related protein B OS=Mus musculus GN=Mybl2 PE=1 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.2e-28 Identity = 56/104 (53.85%), Postives = 75/104 (72.12%), Query Frame = 1
HSP 2 Score: 71.6 bits (174), Expect = 6.1e-12 Identity = 35/102 (34.31%), Postives = 55/102 (53.92%), Query Frame = 1
BLAST of Cucsa.244650 vs. TrEMBL
Match: A0A0A0LA79_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G199590 PE=4 SV=1) HSP 1 Score: 244.2 bits (622), Expect = 7.7e-62 Identity = 113/113 (100.00%), Postives = 113/113 (100.00%), Query Frame = 1
BLAST of Cucsa.244650 vs. TrEMBL
Match: B9RY93_RICCO (R2r3-myb transcription factor, putative OS=Ricinus communis GN=RCOM_0811370 PE=4 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 2.7e-43 Identity = 85/105 (80.95%), Postives = 91/105 (86.67%), Query Frame = 1
BLAST of Cucsa.244650 vs. TrEMBL
Match: A0A059C7S0_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_E02958 PE=4 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 6.1e-43 Identity = 86/107 (80.37%), Postives = 92/107 (85.98%), Query Frame = 1
BLAST of Cucsa.244650 vs. TrEMBL
Match: A0A067LBP5_JATCU (MYB family protein OS=Jatropha curcas GN=JCGZ_15461 PE=4 SV=1) HSP 1 Score: 181.0 bits (458), Expect = 8.0e-43 Identity = 85/106 (80.19%), Postives = 91/106 (85.85%), Query Frame = 1
BLAST of Cucsa.244650 vs. TrEMBL
Match: A0A0D2V6S9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G149000 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.8e-42 Identity = 84/106 (79.25%), Postives = 90/106 (84.91%), Query Frame = 1
BLAST of Cucsa.244650 vs. TAIR10
Match: AT2G23290.1 (AT2G23290.1 myb domain protein 70) HSP 1 Score: 169.9 bits (429), Expect = 9.3e-43 Identity = 81/110 (73.64%), Postives = 90/110 (81.82%), Query Frame = 1
BLAST of Cucsa.244650 vs. TAIR10
Match: AT4G37260.1 (AT4G37260.1 myb domain protein 73) HSP 1 Score: 165.6 bits (418), Expect = 1.8e-41 Identity = 77/106 (72.64%), Postives = 89/106 (83.96%), Query Frame = 1
BLAST of Cucsa.244650 vs. TAIR10
Match: AT3G50060.1 (AT3G50060.1 myb domain protein 77) HSP 1 Score: 163.7 bits (413), Expect = 6.7e-41 Identity = 77/104 (74.04%), Postives = 85/104 (81.73%), Query Frame = 1
BLAST of Cucsa.244650 vs. TAIR10
Match: AT5G67300.1 (AT5G67300.1 myb domain protein r1) HSP 1 Score: 163.3 bits (412), Expect = 8.7e-41 Identity = 76/104 (73.08%), Postives = 85/104 (81.73%), Query Frame = 1
BLAST of Cucsa.244650 vs. TAIR10
Match: AT3G55730.1 (AT3G55730.1 myb domain protein 109) HSP 1 Score: 157.9 bits (398), Expect = 3.7e-39 Identity = 72/104 (69.23%), Postives = 84/104 (80.77%), Query Frame = 1
BLAST of Cucsa.244650 vs. NCBI nr
Match: gi|449446099|ref|XP_004140809.1| (PREDICTED: transcription factor MYB44-like [Cucumis sativus]) HSP 1 Score: 244.2 bits (622), Expect = 1.1e-61 Identity = 113/113 (100.00%), Postives = 113/113 (100.00%), Query Frame = 1
BLAST of Cucsa.244650 vs. NCBI nr
Match: gi|255555281|ref|XP_002518677.1| (PREDICTED: transcription factor MYB44 [Ricinus communis]) HSP 1 Score: 182.6 bits (462), Expect = 3.9e-43 Identity = 85/105 (80.95%), Postives = 91/105 (86.67%), Query Frame = 1
BLAST of Cucsa.244650 vs. NCBI nr
Match: gi|702347303|ref|XP_010057256.1| (PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]) HSP 1 Score: 181.4 bits (459), Expect = 8.8e-43 Identity = 86/107 (80.37%), Postives = 92/107 (85.98%), Query Frame = 1
BLAST of Cucsa.244650 vs. NCBI nr
Match: gi|802540323|ref|XP_012075857.1| (PREDICTED: transcription factor MYB44-like [Jatropha curcas]) HSP 1 Score: 181.0 bits (458), Expect = 1.1e-42 Identity = 85/106 (80.19%), Postives = 91/106 (85.85%), Query Frame = 1
BLAST of Cucsa.244650 vs. NCBI nr
Match: gi|672111213|ref|XP_008799576.1| (PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]) HSP 1 Score: 180.6 bits (457), Expect = 1.5e-42 Identity = 84/107 (78.50%), Postives = 92/107 (85.98%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|