Cucsa.236570 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAGGCATATGGCTGTTGGTGGTTGTGATCAATGAAACTCAGGTGTCCAAGGCAGTGAAATGCGACCCAGGGGAGTTGAGACCATGTCATTTGTCCTTCACAATGTCGATGGAGCCATCGTCGGCTTGTTGCAAGAAGGTGCTGCAGCATAGGACATGCTATTGTGAATATAGTAAAAATCCAAAGACTCAACCTTTTTTtAAAtAA ATGAGAGGCATATGGCTGTTGGTGGTTGTGATCAATGAAACTCAGGTGTCCAAGGCAGTGAAATGCGACCCAGGGGAGTTGAGACCATGTCATTTGTCCTTCACAATGTCGATGGAGCCATCGTCGGCTTGTTGCAAGAAGGTGCTGCAGCATAGGACATGCTATTGTGAATATAGTAAAAATCCAAAGACTCAACCTTTTTTTAAATAA ATGAGAGGCATATGGCTGTTGGTGGTTGTGATCAATGAAACTCAGGTGTCCAAGGCAGTGAAATGCGACCCAGGGGAGTTGAGACCATGTCATTTGTCCTTCACAATGTCGATGGAGCCATCGTCGGCTTGTTGCAAGAAGGTGCTGCAGCATAGGACATGCTATTGTGAATATAGTAAAAATCCAAAGACTCAACCTTTTTTtAAAtAA MRGIWLLVVVINETQVSKAVKCDPGELRPCHLSFTMSMEPSSACCKKVLQHRTCYCEYSKNPKTQPFFK*
BLAST of Cucsa.236570 vs. TrEMBL
Match: A0A0A0M3W7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G711160 PE=4 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 3.5e-33 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Cucsa.236570 vs. TrEMBL
Match: A0A068U392_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00040236001 PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 6.7e-08 Identity = 25/57 (43.86%), Postives = 37/57 (64.91%), Query Frame = 1
BLAST of Cucsa.236570 vs. TrEMBL
Match: A0A0A0KW80_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G141210 PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 8.7e-08 Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 1
BLAST of Cucsa.236570 vs. TrEMBL
Match: A0A068TST2_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00022490001 PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-07 Identity = 27/65 (41.54%), Postives = 40/65 (61.54%), Query Frame = 1
BLAST of Cucsa.236570 vs. TrEMBL
Match: A0A0D2M115_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G202600 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-07 Identity = 25/62 (40.32%), Postives = 39/62 (62.90%), Query Frame = 1
BLAST of Cucsa.236570 vs. TAIR10
Match: AT1G73780.1 (AT1G73780.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 57.8 bits (138), Expect = 3.2e-09 Identity = 24/64 (37.50%), Postives = 36/64 (56.25%), Query Frame = 1
BLAST of Cucsa.236570 vs. TAIR10
Match: AT3G18280.1 (AT3G18280.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 52.8 bits (125), Expect = 1.0e-07 Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = 1
BLAST of Cucsa.236570 vs. TAIR10
Match: AT5G38180.1 (AT5G38180.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 49.3 bits (116), Expect = 1.1e-06 Identity = 21/62 (33.87%), Postives = 37/62 (59.68%), Query Frame = 1
BLAST of Cucsa.236570 vs. TAIR10
Match: AT1G43667.1 (AT1G43667.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 47.4 bits (111), Expect = 4.3e-06 Identity = 18/46 (39.13%), Postives = 29/46 (63.04%), Query Frame = 1
BLAST of Cucsa.236570 vs. NCBI nr
Match: gi|700211810|gb|KGN66906.1| (hypothetical protein Csa_1G711160 [Cucumis sativus]) HSP 1 Score: 148.3 bits (373), Expect = 5.1e-33 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Cucsa.236570 vs. NCBI nr
Match: gi|659118474|ref|XP_008459140.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis melo]) HSP 1 Score: 121.3 bits (303), Expect = 6.6e-25 Identity = 58/74 (78.38%), Postives = 63/74 (85.14%), Query Frame = 1
BLAST of Cucsa.236570 vs. NCBI nr
Match: gi|747042034|ref|XP_011076327.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Sesamum indicum]) HSP 1 Score: 72.0 bits (175), Expect = 4.6e-10 Identity = 29/64 (45.31%), Postives = 43/64 (67.19%), Query Frame = 1
BLAST of Cucsa.236570 vs. NCBI nr
Match: gi|661894311|emb|CDP02752.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 64.3 bits (155), Expect = 9.6e-08 Identity = 25/57 (43.86%), Postives = 37/57 (64.91%), Query Frame = 1
BLAST of Cucsa.236570 vs. NCBI nr
Match: gi|1021520358|ref|XP_016203570.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Arachis ipaensis]) HSP 1 Score: 63.9 bits (154), Expect = 1.3e-07 Identity = 26/62 (41.94%), Postives = 39/62 (62.90%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|