Cucsa.099440 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TAGAGATGGTGGATGTTGCTTTATGCTCAATCACCAATCACAAATCTGATTTCCTTGTGCAAGTTGAAGATGTGCAAAAGTCTCTAAGGAAATTGGAGTCATGCATTTGCGACTTTGAAGAAGATCTCGAGAGTGTATATCGTCGTCTTGTAAAAAACAGAGTCTCTTTTCTTAACATCCTAAATCACTAA TAGAGATGGTGGATGTTGCTTTATGCTCAATCACCAATCACAAATCTGATTTCCTTGTGCAAGTTGAAGATGTGCAAAAGTCTCTAAGGAAATTGGAGTCATGCATTTGCGACTTTGAAGAAGATCTCGAGAGTGTATATCGTCGTCTTGTAAAAAACAGAGTCTCTTTTCTTAACATCCTAAATCACTAA TAGAGATGGTGGATGTTGCTTTATGCTCAATCACCAATCACAAATCTGATTTCCTTGTGCAAGTTGAAGATGTGCAAAAGTCTCTAAGGAAATTGGAGTCATGCATTTGCGACTTTGAAGAAGATCTCGAGAGTGTATATCGTCGTCTTGTAAAAAACAGAGTCTCTTTTCTTAACATCCTAAATCACTAA EMVDVALCSITNHKSDFLVQVEDVQKSLRKLESCICDFEEDLESVYRRLVKNRVSFLNILNH*
BLAST of Cucsa.099440 vs. TrEMBL
Match: A0A0A0K1H9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G023920 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.9e-17 Identity = 50/62 (80.65%), Postives = 51/62 (82.26%), Query Frame = 1
BLAST of Cucsa.099440 vs. TrEMBL
Match: A0A0A0K2R6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G021920 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 9.3e-17 Identity = 47/62 (75.81%), Postives = 53/62 (85.48%), Query Frame = 1
BLAST of Cucsa.099440 vs. TrEMBL
Match: A0A0A0K2S2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G023930 PE=4 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.2e-09 Identity = 36/62 (58.06%), Postives = 44/62 (70.97%), Query Frame = 1
BLAST of Cucsa.099440 vs. TrEMBL
Match: A0A0A0K0T5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G023940 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 2.7e-08 Identity = 36/62 (58.06%), Postives = 44/62 (70.97%), Query Frame = 1
BLAST of Cucsa.099440 vs. TrEMBL
Match: A0A061DYK4_THECC (Eukaryotic translation initiation factor 3 subunit A, putative OS=Theobroma cacao GN=TCM_006496 PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 7.9e-08 Identity = 32/59 (54.24%), Postives = 44/59 (74.58%), Query Frame = 1
BLAST of Cucsa.099440 vs. TAIR10
Match: AT4G35710.1 (AT4G35710.1 Arabidopsis protein of unknown function (DUF241)) HSP 1 Score: 48.1 bits (113), Expect = 2.3e-06 Identity = 22/47 (46.81%), Postives = 33/47 (70.21%), Query Frame = 1
BLAST of Cucsa.099440 vs. TAIR10
Match: AT2G17080.1 (AT2G17080.1 Arabidopsis protein of unknown function (DUF241)) HSP 1 Score: 47.4 bits (111), Expect = 3.9e-06 Identity = 25/49 (51.02%), Postives = 35/49 (71.43%), Query Frame = 1
BLAST of Cucsa.099440 vs. NCBI nr
Match: gi|659094088|ref|XP_008447876.1| (PREDICTED: uncharacterized protein LOC103490230 [Cucumis melo]) HSP 1 Score: 106.3 bits (264), Expect = 2.0e-20 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 1
BLAST of Cucsa.099440 vs. NCBI nr
Match: gi|659094090|ref|XP_008447878.1| (PREDICTED: uncharacterized protein LOC103490231 [Cucumis melo]) HSP 1 Score: 102.8 bits (255), Expect = 2.2e-19 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 1
BLAST of Cucsa.099440 vs. NCBI nr
Match: gi|659094523|ref|XP_008448107.1| (PREDICTED: uncharacterized protein LOC103490394 [Cucumis melo]) HSP 1 Score: 99.4 bits (246), Expect = 2.4e-18 Identity = 49/62 (79.03%), Postives = 54/62 (87.10%), Query Frame = 1
BLAST of Cucsa.099440 vs. NCBI nr
Match: gi|659094080|ref|XP_008447872.1| (PREDICTED: uncharacterized protein LOC103490225 [Cucumis melo]) HSP 1 Score: 96.3 bits (238), Expect = 2.1e-17 Identity = 48/62 (77.42%), Postives = 52/62 (83.87%), Query Frame = 1
BLAST of Cucsa.099440 vs. NCBI nr
Match: gi|778723198|ref|XP_004144940.2| (PREDICTED: uncharacterized protein LOC101211103 [Cucumis sativus]) HSP 1 Score: 95.9 bits (237), Expect = 2.7e-17 Identity = 50/62 (80.65%), Postives = 51/62 (82.26%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |