Cucsa.087810 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATGATTTAGCAGGTCCATTGATAGCATCGATATTGTTTGCGTTTCTATCACCAGGAATGATAATACAGATGCCTGGATCAGAAAAACCACTTGAATTCATGAACTTCAAGACAAGTTTTGCTTCCATTTTTGTTCATGCTGTTGTCTTTCTCCTCCTCCTTATTCTCTTCCTTGTTATGCTCAATCTCCATATTTACATCTAA ATGAATGATTTAGCAGGTCCATTGATAGCATCGATATTGTTTGCGTTTCTATCACCAGGAATGATAATACAGATGCCTGGATCAGAAAAACCACTTGAATTCATGAACTTCAAGACAAGTTTTGCTTCCATTTTTGTTCATGCTGTTGTCTTTCTCCTCCTCCTTATTCTCTTCCTTGTTATGCTCAATCTCCATATTTACATCTAA ATGAATGATTTAGCAGGTCCATTGATAGCATCGATATTGTTTGCGTTTCTATCACCAGGAATGATAATACAGATGCCTGGATCAGAAAAACCACTTGAATTCATGAACTTCAAGACAAGTTTTGCTTCCATTTTTGTTCATGCTGTTGTCTTTCTCCTCCTCCTTATTCTCTTCCTTGTTATGCTCAATCTCCATATTTACATCTAA MNDLAGPLIASILFAFLSPGMIIQMPGSEKPLEFMNFKTSFASIFVHAVVFLLLLILFLVMLNLHIYI*
BLAST of Cucsa.087810 vs. TrEMBL
Match: A0A059APB1_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_I01639 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 4.9e-19 Identity = 46/68 (67.65%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Cucsa.087810 vs. TrEMBL
Match: A9PBG8_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0017s09680g PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 5.4e-18 Identity = 44/68 (64.71%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Cucsa.087810 vs. TrEMBL
Match: A0A061EDX5_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_017236 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 5.4e-18 Identity = 43/68 (63.24%), Postives = 59/68 (86.76%), Query Frame = 1
BLAST of Cucsa.087810 vs. TrEMBL
Match: M5X8J0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppb025443mg PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 7.0e-18 Identity = 46/67 (68.66%), Postives = 57/67 (85.07%), Query Frame = 1
BLAST of Cucsa.087810 vs. TrEMBL
Match: D7MJ07_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_916123 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.2e-17 Identity = 45/68 (66.18%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of Cucsa.087810 vs. TAIR10
Match: AT5G40960.1 (AT5G40960.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 95.1 bits (235), Expect = 1.8e-20 Identity = 45/67 (67.16%), Postives = 55/67 (82.09%), Query Frame = 1
BLAST of Cucsa.087810 vs. TAIR10
Match: AT5G08391.1 (AT5G08391.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 68.6 bits (166), Expect = 1.8e-12 Identity = 30/68 (44.12%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of Cucsa.087810 vs. TAIR10
Match: AT5G63500.1 (AT5G63500.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 67.0 bits (162), Expect = 5.2e-12 Identity = 32/67 (47.76%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Cucsa.087810 vs. TAIR10
Match: AT3G48660.1 (AT3G48660.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 61.6 bits (148), Expect = 2.2e-10 Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of Cucsa.087810 vs. TAIR10
Match: AT3G01950.1 (AT3G01950.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 59.7 bits (143), Expect = 8.2e-10 Identity = 26/63 (41.27%), Postives = 43/63 (68.25%), Query Frame = 1
BLAST of Cucsa.087810 vs. NCBI nr
Match: gi|449441704|ref|XP_004138622.1| (PREDICTED: uncharacterized protein LOC101212134 [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 9.7e-29 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of Cucsa.087810 vs. NCBI nr
Match: gi|702464750|ref|XP_010028988.1| (PREDICTED: uncharacterized protein LOC104419132 [Eucalyptus grandis]) HSP 1 Score: 101.3 bits (251), Expect = 7.0e-19 Identity = 46/68 (67.65%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Cucsa.087810 vs. NCBI nr
Match: gi|802539278|ref|XP_012070230.1| (PREDICTED: uncharacterized protein LOC105632455 [Jatropha curcas]) HSP 1 Score: 100.5 bits (249), Expect = 1.2e-18 Identity = 47/68 (69.12%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Cucsa.087810 vs. NCBI nr
Match: gi|694435511|ref|XP_009344918.1| (PREDICTED: uncharacterized protein LOC103936776 [Pyrus x bretschneideri]) HSP 1 Score: 100.5 bits (249), Expect = 1.2e-18 Identity = 46/67 (68.66%), Postives = 58/67 (86.57%), Query Frame = 1
BLAST of Cucsa.087810 vs. NCBI nr
Match: gi|566212455|ref|XP_006373210.1| (hypothetical protein POPTR_0017s09680g [Populus trichocarpa]) HSP 1 Score: 97.8 bits (242), Expect = 7.7e-18 Identity = 44/68 (64.71%), Postives = 58/68 (85.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|