Cucsa.031840 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAGCAAGTCTATCGGTATGATGCTTGGCATTACATTGGCCAATCGTATAAGGTCCTCAACATCACTTGCTCTTGGGTGCTTTAGCATAGTGACCTTAATCCACATGTTCTGCAATCTAAAATCATACAAATCCATTCAACTAAGGACATTAAATCCTTATCGTGCAA ATGGTGAGCAAGTCTATCGGTATGATGCTTGGCATTACATTGGCCAATCGTATAAGGTCCTCAACATCACTTGCTCTTGGGTGCTTTAGCATAGTGACCTTAATCCACATGTTCTGCAATCTAAAATCATACAAATCCATTCAACTAAGGACATTAAATCCTTATCGTGCAA ATGGTGAGCAAGTCTATCGGTATGATGCTTGGCATTACATTGGCCAATCGTATAAGGTCCTCAACATCACTTGCTCTTGGGTGCTTTAGCATAGTGACCTTAATCCACATGTTCTGCAATCTAAAATCATACAAATCCATTCAACTAAGGACATTAAATCCTTATCGTGCAA MVSKSIGMMLGITLANRIRSSTSLALGCFSIVTLIHMFCNLKSYKSIQLRTLNPYRAX
BLAST of Cucsa.031840 vs. Swiss-Prot
Match: RUS1_ARATH (Protein root UVB sensitive 1, chloroplastic OS=Arabidopsis thaliana GN=RUS1 PE=1 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 1.8e-15 Identity = 40/57 (70.18%), Postives = 48/57 (84.21%), Query Frame = 1
BLAST of Cucsa.031840 vs. TrEMBL
Match: K4CI48_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.9e-16 Identity = 46/57 (80.70%), Postives = 50/57 (87.72%), Query Frame = 1
BLAST of Cucsa.031840 vs. TrEMBL
Match: A0A118JUD4_CYNCS (Uncharacterized protein OS=Cynara cardunculus var. scolymus GN=Ccrd_006650 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.2e-16 Identity = 45/57 (78.95%), Postives = 50/57 (87.72%), Query Frame = 1
BLAST of Cucsa.031840 vs. TrEMBL
Match: M1BL00_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400018482 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.2e-16 Identity = 46/57 (80.70%), Postives = 49/57 (85.96%), Query Frame = 1
BLAST of Cucsa.031840 vs. TrEMBL
Match: M1BL01_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400018482 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.2e-16 Identity = 46/57 (80.70%), Postives = 49/57 (85.96%), Query Frame = 1
BLAST of Cucsa.031840 vs. TrEMBL
Match: A0A0J8B282_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_012650 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.2e-16 Identity = 43/57 (75.44%), Postives = 49/57 (85.96%), Query Frame = 1
BLAST of Cucsa.031840 vs. TAIR10
Match: AT3G45890.1 (AT3G45890.1 Protein of unknown function, DUF647) HSP 1 Score: 82.4 bits (202), Expect = 1.0e-16 Identity = 40/57 (70.18%), Postives = 48/57 (84.21%), Query Frame = 1
BLAST of Cucsa.031840 vs. NCBI nr
Match: gi|778680559|ref|XP_011651345.1| (PREDICTED: protein root UVB sensitive 1, chloroplastic [Cucumis sativus]) HSP 1 Score: 113.6 bits (283), Expect = 1.1e-22 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 1
BLAST of Cucsa.031840 vs. NCBI nr
Match: gi|659098056|ref|XP_008449956.1| (PREDICTED: UPF0420 protein C16orf58 homolog [Cucumis melo]) HSP 1 Score: 107.8 bits (268), Expect = 6.3e-21 Identity = 55/57 (96.49%), Postives = 55/57 (96.49%), Query Frame = 1
BLAST of Cucsa.031840 vs. NCBI nr
Match: gi|460397757|ref|XP_004244433.1| (PREDICTED: protein root UVB sensitive 1, chloroplastic [Solanum lycopersicum]) HSP 1 Score: 92.4 bits (228), Expect = 2.7e-16 Identity = 46/57 (80.70%), Postives = 50/57 (87.72%), Query Frame = 1
BLAST of Cucsa.031840 vs. NCBI nr
Match: gi|970048616|ref|XP_015085810.1| (PREDICTED: protein root UVB sensitive 1, chloroplastic [Solanum pennellii]) HSP 1 Score: 92.0 bits (227), Expect = 3.6e-16 Identity = 46/57 (80.70%), Postives = 50/57 (87.72%), Query Frame = 1
BLAST of Cucsa.031840 vs. NCBI nr
Match: gi|697169604|ref|XP_009593697.1| (PREDICTED: UPF0420 protein C16orf58 homolog, partial [Nicotiana tomentosiformis]) HSP 1 Score: 91.7 bits (226), Expect = 4.7e-16 Identity = 45/57 (78.95%), Postives = 50/57 (87.72%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|