CsaV3_3G019920 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTACCCGAGCAAAATCAGGTATGTTCAAGTCGAAAGCGTGGTTCACATGTATTAAAGACGCTCTACCTACTCCACAATGGAAACAAGCAATGGATGAGGAATATGCTGCCTTACTCAAAGTTAAGACATGGCACTTGGTACCCTCTTCTCCGTATCAAAATATTGTCGGTAACAAGTGGGTATTTCGACTCAAACGAAATTCTGATTGTTCCATTCAACGCTACAAGGCTCAATTGGTTGCCAAAGGTTTTTTTATCAACACCATGACATTGATTTCTTTGAAACATTTAGCCCCGTAG ATGATTACCCGAGCAAAATCAGGTATGTTCAAGTCGAAAGCGTGGTTCACATGTATTAAAGACGCTCTACCTACTCCACAATGGAAACAAGCAATGGATGAGGAATATGCTGCCTTACTCAAAGTTAAGACATGGCACTTGGTACCCTCTTCTCCGTATCAAAATATTGTCGGTAACAAGTGGGTATTTCGACTCAAACGAAATTCTGATTGTTCCATTCAACGCTACAAGGCTCAATTGGTTGCCAAAGGTTTTTTTATCAACACCATGACATTGATTTCTTTGAAACATTTAGCCCCGTAG ATGATTACCCGAGCAAAATCAGGTATGTTCAAGTCGAAAGCGTGGTTCACATGTATTAAAGACGCTCTACCTACTCCACAATGGAAACAAGCAATGGATGAGGAATATGCTGCCTTACTCAAAGTTAAGACATGGCACTTGGTACCCTCTTCTCCGTATCAAAATATTGTCGGTAACAAGTGGGTATTTCGACTCAAACGAAATTCTGATTGTTCCATTCAACGCTACAAGGCTCAATTGGTTGCCAAAGGTTTTTTTATCAACACCATGACATTGATTTCTTTGAAACATTTAGCCCCGTAG MITRAKSGMFKSKAWFTCIKDALPTPQWKQAMDEEYAALLKVKTWHLVPSSPYQNIVGNKWVFRLKRNSDCSIQRYKAQLVAKGFFINTMTLISLKHLAP
BLAST of CsaV3_3G019920 vs. NCBI nr
Match: XP_016899477.1 (PREDICTED: uncharacterized mitochondrial protein AtMg00820-like [Cucumis melo]) HSP 1 Score: 117.9 bits (294), Expect = 2.1e-23 Identity = 59/97 (60.82%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. NCBI nr
Match: XP_016902198.1 (PREDICTED: uncharacterized mitochondrial protein AtMg00810-like isoform X2 [Cucumis melo] >XP_016902199.1 PREDICTED: uncharacterized mitochondrial protein AtMg00810-like isoform X2 [Cucumis melo] >XP_016902200.1 PREDICTED: uncharacterized mitochondrial protein AtMg00810-like isoform X2 [Cucumis melo] >XP_016902201.1 PREDICTED: uncharacterized mitochondrial protein AtMg00810-like isoform X2 [Cucumis melo] >XP_016902202.1 PREDICTED: uncharacterized mitochondrial protein AtMg00810-like isoform X2 [Cucumis melo]) HSP 1 Score: 112.1 bits (279), Expect = 1.1e-21 Identity = 50/67 (74.63%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. NCBI nr
Match: PNX72737.1 (retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Trifolium pratense]) HSP 1 Score: 109.4 bits (272), Expect = 7.3e-21 Identity = 53/98 (54.08%), Postives = 65/98 (66.33%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. NCBI nr
Match: GAU49939.1 (hypothetical protein TSUD_290960 [Trifolium subterraneum]) HSP 1 Score: 106.3 bits (264), Expect = 6.2e-20 Identity = 52/98 (53.06%), Postives = 63/98 (64.29%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. NCBI nr
Match: PNY00673.1 (retrovirus-related Pol polyprotein from transposon TNT 1-94 [Trifolium pratense]) HSP 1 Score: 106.3 bits (264), Expect = 6.2e-20 Identity = 51/98 (52.04%), Postives = 64/98 (65.31%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. TAIR10
Match: ATMG00820.1 (Reverse transcriptase (RNA-dependent DNA polymerase)) HSP 1 Score: 77.4 bits (189), Expect = 5.6e-15 Identity = 47/97 (48.45%), Postives = 58/97 (59.79%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. TAIR10
Match: AT4G23160.1 (cysteine-rich RLK (RECEPTOR-like protein kinase) 8) HSP 1 Score: 63.5 bits (153), Expect = 8.3e-11 Identity = 27/58 (46.55%), Postives = 39/58 (67.24%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. Swiss-Prot
Match: sp|P92520|M820_ARATH (Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana OX=3702 GN=AtMg00820 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.0e-13 Identity = 47/97 (48.45%), Postives = 58/97 (59.79%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. Swiss-Prot
Match: sp|Q94HW2|POLR1_ARATH (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.8e-10 Identity = 39/98 (39.80%), Postives = 52/98 (53.06%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. Swiss-Prot
Match: sp|Q9ZT94|POLR2_ARATH (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.0e-10 Identity = 39/98 (39.80%), Postives = 51/98 (52.04%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. Swiss-Prot
Match: sp|P10978|POLX_TOBAC (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum OX=4097 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.8e-07 Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. TrEMBL
Match: tr|A0A1S4DU00|A0A1S4DU00_CUCME (uncharacterized mitochondrial protein AtMg00820-like OS=Cucumis melo OX=3656 GN=LOC107990535 PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 1.4e-23 Identity = 59/97 (60.82%), Postives = 68/97 (70.10%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. TrEMBL
Match: tr|A0A1S4E1U4|A0A1S4E1U4_CUCME (uncharacterized mitochondrial protein AtMg00810-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC107991581 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 7.5e-22 Identity = 50/67 (74.63%), Postives = 59/67 (88.06%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. TrEMBL
Match: tr|A0A2K3L2G4|A0A2K3L2G4_TRIPR (Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Fragment) OS=Trifolium pratense OX=57577 GN=L195_g028632 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 4.8e-21 Identity = 53/98 (54.08%), Postives = 65/98 (66.33%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. TrEMBL
Match: tr|A0A2K3NCC8|A0A2K3NCC8_TRIPR (Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Trifolium pratense OX=57577 GN=L195_g023958 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 4.1e-20 Identity = 51/98 (52.04%), Postives = 64/98 (65.31%), Query Frame = 0
BLAST of CsaV3_3G019920 vs. TrEMBL
Match: tr|A0A2K3MWC6|A0A2K3MWC6_TRIPR (Copia-type polyprotein OS=Trifolium pratense OX=57577 GN=L195_g018296 PE=4 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 7.0e-20 Identity = 51/98 (52.04%), Postives = 64/98 (65.31%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |