CsaV3_1G029600 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGAAGATCGGTGCACTCTTCCTTAACATATTAGTACTGTCGGTAGTGGCAGCAGAGGCGGACAAGACGGCTGCGGCGGTAAACTTGAAGGTGGGTGTGGTTTTGGATTTGAATGATGTTGTTGGGAAGATGGGTTCGAGTTGCATTAATATGACGCTCTCTGATTTTTATGCCAATCGAAGTTATTATAAGACGAAATTGATTCTCAATCCCATGGACTCCAATGGAACGAACTATCGTTGGTGCAGCTACAGTAG ATGTTGAAGATCGGTGCACTCTTCCTTAACATATTAGTACTGTCGGTAGTGGCAGCAGAGGCGGACAAGACGGCTGCGGCGGTAAACTTGAAGGTGGGTGTGGTTTTGGATTTGAATGATGTTGTTGGGAAGATGGGTTCGAGTTGCATTAATATGACGCTCTCTGATTTTTATGCCAATCGAAGTTATTATAAGACGAAATTGATTCTCAATCCCATGGACTCCAATGGAACGAACTATCGTTGGTGCAGCTACAGTAG ATGTTGAAGATCGGTGCACTCTTCCTTAACATATTAGTACTGTCGGTAGTGGCAGCAGAGGCGGACAAGACGGCTGCGGCGGTAAACTTGAAGGTGGGTGTGGTTTTGGATTTGAATGATGTTGTTGGGAAGATGGGTTCGAGTTGCATTAATATGACGCTCTCTGATTTTTATGCCAATCGAAGTTATTATAAGACGAAATTGATTCTCAATCCCATGGACTCCAATGGAACGAACTATCGTTGGTGCAGCTACAGTAG MLKIGALFLNILVLSVVAAEADKTAAAVNLKVGVVLDLNDVVGKMGSSCINMTLSDFYANRSYYKTKLILNPMDSNGTNYRWCSYSX
BLAST of CsaV3_1G029600 vs. NCBI nr
Match: KGN47385.1 (hypothetical protein Csa_6G308940 [Cucumis sativus]) HSP 1 Score: 150.6 bits (379), Expect = 2.5e-33 Identity = 80/86 (93.02%), Postives = 82/86 (95.35%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. NCBI nr
Match: XP_023002214.1 (glutamate receptor 2.2-like [Cucurbita maxima]) HSP 1 Score: 73.2 bits (178), Expect = 5.0e-10 Identity = 39/74 (52.70%), Postives = 55/74 (74.32%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. NCBI nr
Match: XP_012455154.1 (PREDICTED: glutamate receptor 2.8-like [Gossypium raimondii] >XP_012455221.1 PREDICTED: glutamate receptor 2.8-like [Gossypium raimondii] >KJB07709.1 hypothetical protein B456_001G039900 [Gossypium raimondii]) HSP 1 Score: 72.4 bits (176), Expect = 8.5e-10 Identity = 37/73 (50.68%), Postives = 51/73 (69.86%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. NCBI nr
Match: XP_016744596.1 (PREDICTED: glutamate receptor 2.8-like [Gossypium hirsutum]) HSP 1 Score: 71.6 bits (174), Expect = 1.5e-09 Identity = 37/73 (50.68%), Postives = 50/73 (68.49%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. NCBI nr
Match: XP_023537857.1 (glutamate receptor 2.1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 71.6 bits (174), Expect = 1.5e-09 Identity = 37/55 (67.27%), Postives = 45/55 (81.82%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TAIR10
Match: AT5G48400.2 (Glutamate receptor family protein) HSP 1 Score: 50.4 bits (119), Expect = 6.3e-07 Identity = 25/50 (50.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TAIR10
Match: AT2G29110.1 (glutamate receptor 2.8) HSP 1 Score: 46.6 bits (109), Expect = 9.1e-06 Identity = 23/46 (50.00%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TAIR10
Match: AT2G29100.1 (glutamate receptor 2.9) HSP 1 Score: 44.7 bits (104), Expect = 3.5e-05 Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TAIR10
Match: AT5G11180.1 (glutamate receptor 2.6) HSP 1 Score: 44.7 bits (104), Expect = 3.5e-05 Identity = 25/71 (35.21%), Postives = 39/71 (54.93%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TAIR10
Match: AT2G29120.1 (glutamate receptor 2.7) HSP 1 Score: 42.4 bits (98), Expect = 1.7e-04 Identity = 22/46 (47.83%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. Swiss-Prot
Match: sp|Q9LV72|GLR12_ARATH (Glutamate receptor 1.2 OS=Arabidopsis thaliana OX=3702 GN=GLR1.2 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-05 Identity = 25/50 (50.00%), Postives = 35/50 (70.00%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. Swiss-Prot
Match: sp|Q9C5V5|GLR28_ARATH (Glutamate receptor 2.8 OS=Arabidopsis thaliana OX=3702 GN=GLR2.8 PE=2 SV=2) HSP 1 Score: 46.6 bits (109), Expect = 1.6e-04 Identity = 23/46 (50.00%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. Swiss-Prot
Match: sp|Q9LFN5|GLR25_ARATH (Glutamate receptor 2.5 OS=Arabidopsis thaliana OX=3702 GN=GLR2.5 PE=2 SV=2) HSP 1 Score: 45.8 bits (107), Expect = 2.8e-04 Identity = 27/72 (37.50%), Postives = 44/72 (61.11%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. Swiss-Prot
Match: sp|Q9LFN8|GLR26_ARATH (Glutamate receptor 2.6 OS=Arabidopsis thaliana OX=3702 GN=GLR2.6 PE=2 SV=2) HSP 1 Score: 44.7 bits (104), Expect = 6.2e-04 Identity = 25/71 (35.21%), Postives = 39/71 (54.93%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. Swiss-Prot
Match: sp|O81078|GLR29_ARATH (Glutamate receptor 2.9 OS=Arabidopsis thaliana OX=3702 GN=GLR2.9 PE=2 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 6.2e-04 Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TrEMBL
Match: tr|A0A0A0KCD3|A0A0A0KCD3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G308940 PE=4 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 1.6e-33 Identity = 80/86 (93.02%), Postives = 82/86 (95.35%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TrEMBL
Match: tr|A0A0D2PLI2|A0A0D2PLI2_GOSRA (Glutamate receptor OS=Gossypium raimondii OX=29730 GN=B456_001G039900 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 5.6e-10 Identity = 37/73 (50.68%), Postives = 51/73 (69.86%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TrEMBL
Match: tr|A0A1U8P056|A0A1U8P056_GOSHI (Glutamate receptor OS=Gossypium hirsutum OX=3635 GN=LOC107953718 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 9.6e-10 Identity = 37/73 (50.68%), Postives = 50/73 (68.49%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TrEMBL
Match: tr|A0A2P5RK57|A0A2P5RK57_GOSBA (Glutamate receptor OS=Gossypium barbadense OX=3634 GN=GOBAR_DD15879 PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 1.6e-09 Identity = 36/73 (49.32%), Postives = 51/73 (69.86%), Query Frame = 0
BLAST of CsaV3_1G029600 vs. TrEMBL
Match: tr|A0A1S3BCB6|A0A1S3BCB6_CUCME (Glutamate receptor OS=Cucumis melo OX=3656 GN=LOC103488369 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.8e-09 Identity = 34/51 (66.67%), Postives = 42/51 (82.35%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|